Stappia indica: GH266_15075
Help
Entry
GH266_15075 CDS
T06350
Name
(GenBank) universal stress protein
Organism
siw
Stappia indica
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Usp
Motif
Other DBs
NCBI-ProteinID:
QGZ35699
UniProt:
A0A857C9Z2
LinkDB
All DBs
Position
3210761..3211621
Genome browser
AA seq
286 aa
AA seq
DB search
MTKLIALVDGSVYSRSVCEHAAWIAARAGEGARVELLHVLGRRQAEGGAANLSGNIALGA
RTALLNELAELDERAAKLAKARGRAILDDAAKVLDEAGVADVTTRLRSGDLVETLAEMEA
DADLVIVGKRGEAADFAKLHLGSNLERIARSARKPIFVAARAFRPIKRLLIAYDGGASAL
KAVDHIARGSILSGLDCHLLMVGEETAEGRRSLDGAAAMLKGGGFAVTAGIRSGQAETVI
AEAVEQDGIDLLVMGAYGHSRIRSLIIGSTTTEMIRSCKIPVLLFR
NT seq
861 nt
NT seq
+upstream
nt +downstream
nt
atgaccaaactgatcgcgctggtggacggctccgtctattcccgcagcgtctgcgagcat
gccgcctggattgcggcgcgcgccggcgagggggcacgcgtcgagctgctgcatgtgctc
ggccggcgccaggcggaaggcggggcggcgaacctctcgggcaacatcgcgctcggcgcc
cgtacggcgctgctcaacgaactggccgagctcgacgagcgggcggcgaagcttgccaag
gcccgcggccgggcgatcctcgacgatgcggccaaggtgctggacgaggccggcgttgcg
gatgtcacgacgcggctgcgctccggcgatctcgtcgagacgctggcggagatggaggcg
gatgccgatctcgtcatcgtcggcaagcgcggcgaggcggcggatttcgcaaagctccat
ctcggctccaacctggagcggatcgcccgcagcgcccgcaagccgatcttcgtggcggcc
cgcgcctttcgcccgatcaagcggctgctgatcgcctatgacggcggcgccagcgcgctg
aaggcggtcgaccatatcgcccgcggctcgatcctttccggtctcgactgccatctgctg
atggtgggcgaggagacggcggaaggccgccgcagcctggacggggcggcggcgatgctg
aagggcggcggctttgccgtcaccgccgggatccgctccggccaggcggagacggtgatc
gcggaagcggtggaacaggacggcatcgaccttctcgtcatgggcgcctacggccattcg
cggatccgctcgctgatcatcggctcgacgacgaccgagatgatccgctcctgcaagatc
ccggtcctgctgttccgctaa
DBGET
integrated database retrieval system