Stappia indica: GH266_18500 Help Entry GH266_18500       CDS       T06350                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism siw  Stappia indica Pathway siw00190   Oxidative phosphorylation siw01100   Metabolic pathways Module siw_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:siw00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     GH266_18500  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:siw00194]     GH266_18500 Photosynthesis proteins [BR:siw00194]  Photosystem and electron transport system   F-type ATPase [OT]    GH266_18500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QGZ36300 UniProt:  A0A285SPF3 LinkDB All DBs Position 3970777..3971004 Genome browser AA seq 75 aa AA seqDB search MEAEAAKYIGAGLACLGMAGTALGLGNIFGSYLSGALRNPSAADGQFGRLIFGFAVTEAL GIFSLLVALLLLFAV NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggaagctgaagcagcaaagtacattggtgcgggtctcgcctgccttggcatggccggt accgctctcggcctcggcaacatcttcggcagctacctgtcgggcgccctgcgcaatccg tccgccgctgatggccagttcggccgcctcattttcggctttgccgtgaccgaggcgctc ggcattttctcgcttctcgtcgcccttctcctgctcttcgccgtctga

DBGET integrated database retrieval system