Sinorhizobium sp. RAC02: BSY16_1709 Help Entry BSY16_1709        CDS       T04514                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism six  Sinorhizobium sp. RAC02 Pathway six01100   Metabolic pathways six01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:six00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BSY16_1709 (acpP)    00074 Mycolic acid biosynthesis     BSY16_1709 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BSY16_1709 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Delta_lysin Motif Other DBs NCBI-ProteinID:  AOF90084 LinkDB All DBs Position complement(1777464..1777700) Genome browser AA seq 78 aa AA seqDB search MSDVAERVKKIVIDHLGVDAEKVSEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtagcagaacgcgtaaagaaaattgtcattgatcatctgggcgttgacgcc gaaaaagtcagcgaaggcgcaagtttcatcgatgatcttggcgcggactcgctcgacacc gtcgaactggtcatggcgttcgaagaagagttcggcgtcgagatcccggacgatgccgct gactcgatcctgacggtcggcgacgccgtcaagttcatcgagaaggcccaggcctaa

DBGET integrated database retrieval system