KEGG   Sphingobium japonicum: SJA_C1-21130
Entry
SJA_C1-21130      CDS       T01201                                 
Symbol
tfdD
Name
(GenBank) (chloro)muconate cycloisomerase
  KO
K01860  chloromuconate cycloisomerase [EC:5.5.1.7]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00361  Chlorocyclohexane and chlorobenzene degradation
sjp00364  Fluorobenzoate degradation
sjp00623  Toluene degradation
sjp01100  Metabolic pathways
sjp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    SJA_C1-21130 (tfdD)
   00361 Chlorocyclohexane and chlorobenzene degradation
    SJA_C1-21130 (tfdD)
   00623 Toluene degradation
    SJA_C1-21130 (tfdD)
Enzymes [BR:sjp01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.7  chloromuconate cycloisomerase
     SJA_C1-21130 (tfdD)
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C ComA
Other DBs
NCBI-ProteinID: BAI96947
NITE: SJA_C1-21130
UniProt: D4Z2W5
LinkDB
Position
1:complement(2110480..2111685)
AA seq 401 aa
MDKAAVSQGRASEGAAGGRDALVFGRTPIETARIRSIETRIVDLPLRRLQQFARFGTHLQ
SIVLVEILTEDGVTGIGEAVTPCGPWWSGDSVEAIKATIDRYLAPLLVGENLLAPTRLMA
KLDQKVRNNSFAKAGIEMALLDGAGKILDVPLHILFGGKMRDSLPVAWPLATGDVAQEID
EAEEMLALGRAGAFKLKMAALPIAEDLARAKRLARALEGRAKLRVDPNEGWEEATAVRAI
AELREAGVEMVEQPVARWNLDAMARLTRSSGTTIMIDEGVLSVHDTVEVVKRAAASLLSL
KIMKSGGLRNARAMADIANAGGIPVYMGTFLESSIGTAANMHLAASLPALPLGGETIGPM
LIGEDICVAPADYHDHALWLPEGPGLGIEIDREKLARFQRK
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggataaggcagcggtttcgcaagggcgtgcgtcggaaggagcggccggcgggcgcgat
gcgctggtcttcggccggacgcccatcgaaacggcgaggatacggagcatcgaaacgcgg
atcgtcgacctgccgctgcgtcggctccagcagttcgcgcggttcggcactcaccttcag
agcatcgtccttgtcgagatactgaccgaagacggggtaacgggcatcggcgaggccgtc
acgccctgcggcccctggtggagcggcgacagcgtcgaggcgatcaaggcgacgatcgac
cgctatctggcgccgctgctcgtgggcgagaacctgctcgcgccgacccgactgatggcg
aagctggaccagaaggtccgcaacaacagctttgcgaaggcggggatcgagatggcgttg
ctcgacggcgcgggaaagatcctcgacgtgccgctgcatatcctgttcgggggcaagatg
cgcgattcgctccccgtggcctggccgctggcgacgggcgatgtcgcgcaggaaatcgac
gaggccgaagagatgctggcgctcggacgcgccggcgccttcaagctgaagatggccgcg
ctgcccatcgcggaagacctcgcccgcgcaaagcggctggcgcgcgcccttgaagggcgg
gcgaagctgcgggtcgatcccaatgaaggctgggaagaggcgactgccgtccgggcgatc
gccgagctgcgcgaggccggcgtcgagatggtcgaacagcctgtggcgcgctggaacctc
gacgcgatggcgcgcctcacccggtccagcggcaccacgatcatgatcgacgagggcgtc
ctgtcggtccacgacacggtggaggtggtcaagcgcgccgccgccagcctgctgtcgctc
aagatcatgaaatccggcgggctgcgcaatgcccgcgccatggccgacattgcgaatgcg
gggggcattcccgtctatatgggcaccttcctcgaatcctcgatcgggactgcggcgaac
atgcatcttgccgcgagccttccggccctgccgctcggcggagagacgatcggaccgatg
ttgatcggcgaggacatctgcgtcgcgcctgccgactatcacgatcatgcgctctggctg
cccgaagggccgggactcggaatcgagatcgatcgcgagaagctggcgcgattccagaga
aaatag

DBGET integrated database retrieval system