Sphingobium indicum UT26S: SJA_C1-32580
Help
Entry
SJA_C1-32580 CDS
T01201
Symbol
clpS
Name
(GenBank) ATP-dependent Clp protease adaptor protein ClpS
KO
K06891
ATP-dependent Clp protease adaptor protein ClpS
Organism
sjp
Sphingobium indicum UT26S
Brite
KEGG Orthology (KO) [BR:
sjp00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99975 Protein processing
SJA_C1-32580 (clpS)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ClpS
Motif
Other DBs
NCBI-ProteinID:
BAI98092
UniProt:
D4Z660
LinkDB
All DBs
Position
1:3240645..3241052
Genome browser
AA seq
135 aa
AA seq
DB search
MREQIAISSPIMSSSTTMAYSVTMAGRDQDDQGDGSGGPNVGIATRTRARTKKPSLYKVL
MLNDDYTPMEFVVHVLQQFFRMDMEEATRVMLHVHQRGVGVCGIFSYEVAETKVNQVMDF
ARQNQHPLQCTLEKA
NT seq
408 nt
NT seq
+upstream
nt +downstream
nt
atgcgggagcaaatcgccatatcctcgcccatcatgagcagctccacgacgatggcatat
tccgtgacgatggcgggcagggatcaggacgaccagggcgacggctcgggcggtcccaat
gtcggcattgccacgcgcacccgcgcccggacgaaaaagccctctctctacaaggtgctg
atgctgaacgacgactacacgccgatggaattcgtcgtgcacgtcctccagcaattcttc
cgcatggacatggaggaggcgacccgcgtgatgctccacgtccaccagcgcggcgtcggc
gtgtgcggcattttcagctatgaggtggcggaaacgaaggtgaaccaggtcatggacttc
gcccgccagaaccagcacccgctccagtgcaccctggaaaaggcatag
DBGET
integrated database retrieval system