Streptomyces kanamyceticus: CP970_02200 Help Entry CP970_02200       CDS       T06849                                  Name (GenBank) acyl carrier protein   KO K16025   methoxymalonate biosynthesis acyl carrier protein Organism ska  Streptomyces kanamyceticus Pathway ska01051   Biosynthesis of ansamycins ska01052   Type I polyketide structures Brite KEGG Orthology (KO) [BR:ska00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01052 Type I polyketide structures     CP970_02200    01051 Biosynthesis of ansamycins     CP970_02200  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ska01008]     CP970_02200 Polyketide biosynthesis proteins [BR:ska01008]  Polyketide tailoring proteins   Others    CP970_02200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEU89896 UniProt:  E9KTB1 LinkDB All DBs Position complement(539979..540239) Genome browser AA seq 86 aa AA seqDB search MTVPVKDDPVARELVAFLETKTRSDWSVERDLFAEGGLSSLFALELVVFLEKTFGVEIGG PDLQLVNFRTVVSMVELVHRLRGEGA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtgacagtccccgtcaaggacgatcccgtcgcgcgtgagctggtcgcgttcctggagacg aagaccaggtcggactggtcggtggagcgcgacctgttcgcggagggcggcctgtcgtcg ctgttcgcgctggagttggtggtgttcctggagaagacgttcggcgtggagatcgggggc ccggaccttcagttggtgaacttccggaccgtcgtgtccatggtcgaactcgtccaccgg ctgcggggcgagggtgcctga

DBGET integrated database retrieval system