Streptomyces kanamyceticus: CP970_02730 Help Entry CP970_02730       CDS       T06849                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism ska  Streptomyces kanamyceticus Pathway ska00253   Tetracycline biosynthesis ska01056   Biosynthesis of type II polyketide backbone ska01100   Metabolic pathways ska01110   Biosynthesis of secondary metabolites Module ska_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:ska00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     CP970_02730    00253 Tetracycline biosynthesis     CP970_02730  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:ska01004]     CP970_02730    01008 Polyketide biosynthesis proteins [BR:ska01008]     CP970_02730 Lipid biosynthesis proteins [BR:ska01004]  Polyketide synthase   Component type    CP970_02730 Polyketide biosynthesis proteins [BR:ska01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      CP970_02730     Nonaketide PKS      CP970_02730     Decaketide PKS      CP970_02730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QEU89963 UniProt:  A0A5J6G4U5 LinkDB All DBs Position complement(675821..676078) Genome browser AA seq 85 aa AA seqDB search MTGITAQDMVRLLTESAGDLDFSGPPEDVLDLTFEELGCDSLALLETAARIQQDYGVELP DDLATGLATPRSLMEAINTSPAKAG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaccgggatcaccgcacaggacatggtccgcctgctcaccgagagcgccggggacctc gatttctcggggcctcccgaagacgtcctcgacctgaccttcgaggagctcggctgtgac tcgctggccctcctggagaccgcggcacggatccagcaggactacggcgtcgagctcccc gacgacctggcgaccgggctcgcgaccccgcgctcactgatggaggccatcaacaccagc cccgccaaggccggttga

DBGET integrated database retrieval system