Streptomyces kanamyceticus: CP970_40315 Help Entry CP970_40315       CDS       T06849                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ska  Streptomyces kanamyceticus Pathway ska00261   Monobactam biosynthesis ska01100   Metabolic pathways ska01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ska00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP970_40315  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ska01008]     CP970_40315 Polyketide biosynthesis proteins [BR:ska01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP970_40315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEU96355 UniProt:  A0A5J6GQL9 LinkDB All DBs Position 9287233..9287451 Genome browser AA seq 72 aa AA seqDB search MANPFENEEGQYLVLVNDEEQHSLWPATIEVPAGWRTAHGADSRAECLAYIERTWTDMRP AGLRREMDEVAS NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggcgaatcccttcgaaaacgaagagggccagtatctggtcctcgtcaacgacgaggag cagcactccctgtggcccgccacgatcgaggtgcccgcgggctggcgcaccgcgcacggc gcggacagtcgcgccgagtgcctcgcgtacatcgagcggacctggaccgacatgcgcccc gcgggcctgcgtcgcgagatggacgaggtggcctcgtag

DBGET integrated database retrieval system