KEGG   Streptomyces kanamyceticus: CP970_43085
Entry
CP970_43085       CDS       T06849                                 

Symbol
speB
Name
(GenBank) agmatinase
  KO
K12676  proclavaminate amidinohydrolase [EC:3.5.3.22]
Organism
ska  Streptomyces kanamyceticus
Pathway
ska00331  Clavulanic acid biosynthesis
ska01100  Metabolic pathways
ska01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ska00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    CP970_43085 (speB)
Enzymes [BR:ska01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.22  proclavaminate amidinohydrolase
     CP970_43085 (speB)
SSDB
Motif
Pfam: Arginase
Other DBs
NCBI-ProteinID: QEU96829
UniProt: A0A5J6GN38
LinkDB
Position
complement(9932243..9933220)
AA seq 325 aa
MERIDTTVSPRYAQIPTFMRLPHDPEPRGKDVVVIGAPYDGGTSYRPGARFGPRAIRDES
GLIHGVGIDRGPGTFDLIDCVDAGDIDLTPFNMHIAMATAQERLSGLLSDNAAFLMLGGD
HSLTLAALRAVAALHGPVAVLHLDAHSDTNPAFYGGEYHHGTPFRHAIEEKLVDPRRMAQ
IGIRGHNPRPDSLDYARGHGVRIITCDEFCSLGPERTGELVRGLVGEAPVYVSVDIDVMD
PAFAPGTGTPAPGGLTSREVLALLRGIGELRPVGFDVMEVSPLYDHGGITSVLATEIGAE
LLYQYARAHSRDSYDSRDSRERTPS
NT seq 978 nt   +upstreamnt  +downstreamnt
gtggaacgcatcgacaccaccgtctcgcctcgctacgcgcagatccccacgttcatgcgc
ctgccgcacgacccggagccacggggcaaggacgtcgtcgtcatcggcgccccctacgac
ggcggcaccagctaccggccaggcgcgcgcttcggtccgcgcgccatccgcgacgagtcc
gggctcatccacggcgtgggcatcgaccgcgggcccggcaccttcgacctgatcgactgc
gtcgacgccggggacatcgacctgaccccgttcaacatgcacatcgccatggccaccgcc
caggagagactgagcggcctcctgtcggacaacgcggccttcctcatgctcggcggcgac
cactcgctgacgctggccgcgctgcgcgccgtcgcggccctgcacggtcccgtcgccgtc
ctgcacctggacgcgcactccgacaccaaccccgccttctacggcggcgagtaccaccac
ggcacacccttccggcacgccatcgaagagaagctcgtcgatccccggcggatggcgcag
atcggcatccggggtcacaacccgcgccccgactcgctcgactacgcccgcggacacggc
gtacggatcatcacctgtgacgaattctgctcactgggccccgagcgcaccggcgagctc
gtccgcggcctcgtcggggaagcgcccgtctacgtgtcggtggacatcgacgtcatggac
cccgcgttcgcccccggcaccggcacgcccgcgccgggcggcctcacctcgcgcgaggtg
ctcgccctgctgcgcggcatcggcgagctgcgcccggtgggcttcgacgtcatggaggtc
tcgccgctgtacgaccacgggggcatcacctccgtgctggccaccgagatcggcgcggag
ctgctgtaccagtacgcccgcgcgcactcccgagactcatacgactcccgagactcccga
gaaaggacaccctcatga

DBGET integrated database retrieval system