Shewanella khirikhana: STH12_00957
Help
Entry
STH12_00957 CDS
T06711
Symbol
copA_1
Name
(GenBank) Copper-exporting P-type ATPase A
KO
K17686
P-type Cu+ transporter [EC:
7.2.2.8
]
Organism
skh
Shewanella khirikhana
Brite
Enzymes [BR:
skh01000
]
7. Translocases
7.2 Catalysing the translocation of inorganic cations
7.2.2 Linked to the hydrolysis of a nucleoside triphosphate
7.2.2.8 P-type Cu+ transporter
STH12_00957 (copA_1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
E1-E2_ATPase
Hydrolase
HMA
HAD
Hydrolase_3
DUF7283
Motif
Other DBs
NCBI-ProteinID:
AZQ10093
UniProt:
A0ABM7D142
LinkDB
All DBs
Position
1111407..1113923
Genome browser
AA seq
838 aa
AA seq
DB search
MNSVHLTVPGMKCGGCGKKITSLLATEGWQIHTDPAGKRLDISAASAIDVDDVLARLEAG
GYPATLMDEPLAAAPPELAPDAGQMAFDADKVAAGEPSAAAAITHTALRFSVPSMSCASC
VAKIEAALRSAGGEGRVDLSRKVVRVKGLSADAALAALSGVGYPGELLTAQPKPASDDGQ
HFRTRLWQAAVGLGLGVPLMLWGLFGGEMMVNDATRLGWGLVGLITGVAMLLTGAHFYQG
LWRSLKAKSATMDTLIALGTGTAWLYSMALVLLPQAFPEGSRHVYFEASVMILGLINLGH
ALEARARGKTSEALDKLLGLKTDEALRLENGTERWVRVEEIARNDLIRVRPGDRIALDGK
VIEGESLIDESMLSGEPLPVAKTAGESVFAGTVNGNGSLVIEVTAEADDSRLSKIIALVE
EAQTSKLPIGRLTDAISAVFVPVVVAIAIVAALIWYFVGPAPALSHAMVVLTTVLIIACP
CALGLATPMSIMVGVGRAASMGILVKNGEALERASKVTTVVLDKTGTLTLGKPAVRKMLW
LQGDEEDTRHAIASLERQSSHPLSEALAALSDVPSLAVSEFQNLPGEGLMGKVTATDGSH
GWHIGNPRLMARLGLASELETLEPELDSLAKEALTPVLVAKNHKLVAILGVGDPLRADAK
TAMARLKAQGKRLVLLSGDNRHTAEAVGREVGIDEVIAGVMPDEKHQHVARLKAAGEVVA
MVGDGINDAPALAEADVGIAMGTGTDVAIESASLTLLSPRLEALADAFALSRATLGNIRQ
NLFGAFIYNVLGIPVAAGVLYPAFGVLLSPVLAGAAMAASSLTVVTNANRLKRKPLKD
NT seq
2517 nt
NT seq
+upstream
nt +downstream
nt
atgaacagcgtacatctcaccgtgcccggtatgaaatgtggcggctgcggcaaaaaaatc
acctcgctgctggccacagaaggctggcaaatacacacagatcccgccggtaagcggctc
gatatcagtgcagcgtcggccattgatgtggatgatgtgctggcgcggctcgaagccggt
ggctatcccgcaacgctgatggatgaacctttggcagcagcgccgccggagttggcaccc
gatgccggtcaaatggcctttgatgccgataaggtggcagccggggagccttcggctgcg
gctgcaatcactcacacggcactgcgcttcagcgtgccttccatgagctgcgccagttgt
gtggccaagattgaagcggcgctgcgctcagccggcggtgagggccgggtcgatttgtcc
cgtaaagtggtgcgggtaaaaggcttatccgccgatgcagcgctggcggcgctgagcggt
gttggttatcccggcgagctcctcaccgcacagccgaagcccgccagcgacgatggacag
cattttcgaaccagactgtggcaggcggccgtggggctggggctcggggtgcccttaatg
ctatggggactttttggcggcgagatgatggtgaacgatgctacccgccttggctgggga
ctggtggggctgataacaggtgttgctatgctgctgaccggtgctcacttctaccaagga
ctttggcgctcattaaaggccaaaagtgccaccatggacaccctcatagctttggggact
ggcacagcctggctctattccatggccctggtgctgctgccacaggcgtttcccgaaggc
agtcgccatgtgtatttcgaagcgagcgtgatgattttgggtttaataaaccttggccat
gcgctggaggcgcgggcgaggggcaaaaccagcgaggcgctggataaactgcttgggctt
aaaactgatgaggcgctgcggcttgaaaacggcactgagcgctgggtcagggtggaagag
attgcccgcaacgacctgattcgggtacggccgggcgacaggattgccctcgatggcaag
gttatcgaaggtgagtcgctgattgatgagtccatgctatccggtgagccgctgccggtg
gccaaaaccgcaggggaaagtgtgtttgccgggacggtaaatggcaacggcagtctggtt
attgaagtgaccgccgaggccgatgacagtcgattgtcgaaaatcatcgcgctggtggaa
gaggcgcaaacctcgaaactgcccataggccggcttactgatgctatttcggcggtattt
gtgcctgtggtggtggccattgctattgttgccgcgctgatctggtactttgttggcccc
gcgcccgcattgtcacatgccatggtggtgctcaccactgtgctgattattgcctgcccc
tgtgcccttgggcttgccacgcccatgtcgattatggtcggggtagggcgcgccgcctcc
atggggattttggttaaaaacggtgaagcacttgagcgggccagcaaggtcaccacagtg
gtgctggataaaacaggcaccctgacgctgggtaaacctgcggtgcgaaagatgctctgg
cttcaaggtgatgaagaggatacccggcatgcaatagcaagccttgagcgccagagcagc
catccgctgtcggaggcgcttgcggccctgtcggatgtgccttcgcttgcggtgagcgaa
tttcaaaacctgcccggcgaaggccttatgggtaaggtcaccgccacagatggcagccat
gggtggcatatcggtaatccacgtctgatggcgcgccttggcctggcatcagaacttgaa
acgcttgagccggaacttgattccctggccaaagaggcgctcacccctgtgctggtggct
aaaaatcacaagcttgtggccatactcggtgtgggcgacccactcagagccgatgccaaa
accgcaatggcgcgccttaaagcccagggcaagcgcttggtgttgctgtcaggggataac
cggcacactgccgaggcggttggccgcgaggtgggtatcgatgaagtgattgccggggtg
atgccagatgaaaagcatcagcatgttgcccgtcttaaggcggctggcgaagtggtggcc
atggtgggggatggcattaatgatgccccggcgctggccgaagccgatgtggggattgcc
atgggcacgggaaccgatgtcgccattgagagcgcgtctctgaccttgctgtcacccagg
ctcgaggcccttgccgatgcctttgccctgtcgcgcgctacccttggcaatattcgccag
aacctctttggtgcctttatttacaatgtgctgggcattccggtggcggcgggcgtgctt
tatccggcgtttggggtgctgttaagcccggttctggccggggcggcgatggcggcctca
tcgctgactgtggtgaccaatgccaaccggcttaaaagaaagccgctaaaggattaa
DBGET
integrated database retrieval system