Shewanella khirikhana: STH12_03314 Help Entry STH12_03314       CDS       T06711                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism skh  Shewanella khirikhana Pathway skh01100   Metabolic pathways skh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:skh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     STH12_03314    00074 Mycolic acid biosynthesis     STH12_03314   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     STH12_03314 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AZQ12374 LinkDB All DBs Position 3772537..3772797 Genome browser AA seq 86 aa AA seqDB search MTLHDQIKQLIIDCLDLEDVTIADIETDAPLFGDGLGLDSIDALELGLAIKKQFDVKIEA NSDATKAHFYSVATLASFIESQRGQE NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacattacacgaccaaatcaaacagctgatcatcgactgcctcgacctggaagacgtg accattgctgacatagaaaccgatgcgcctctgttcggcgacggcctgggactggactcc atcgatgcgctcgagctgggtctggccattaaaaagcaattcgatgtgaagattgaagcc aactccgacgcgaccaaggctcacttctacagcgtggcaacccttgccagctttatcgaa tctcagcgtggtcaggagtaa

DBGET integrated database retrieval system