Shewanella khirikhana: STH12_03315 Help Entry STH12_03315       CDS       T06711                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism skh  Shewanella khirikhana Pathway skh01100   Metabolic pathways skh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:skh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     STH12_03315 (acpP_2)    00074 Mycolic acid biosynthesis     STH12_03315 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     STH12_03315 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AZQ12375 UniProt:  A0ABN5U1H0 LinkDB All DBs Position 3772802..3773050 Genome browser AA seq 82 aa AA seqDB search MDNREQILEKLTTILVDDFEIDADAISLEANLYQDLDLDSIDAVDLVIKLQQLTGKKIKP EEFKSVRTVEDVVNAIEALVQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggacaatcgcgagcaaattcttgaaaagctgaccaccattctggtggacgattttgaa atcgacgccgatgccatcagcctggaagccaacctgtatcaggacctggatctggacagc atcgatgcggtggatctggtgatcaagctgcagcagctcaccggcaaaaagattaagccc gaagagttcaaatcggtgcgcaccgtagaagatgtggttaacgccatcgaggcgctggtt cagggctga

DBGET integrated database retrieval system