Saccoglossus kowalevskii (acorn worm): 100313571 Help Entry 100313571         CDS       T04123                                  Name (RefSeq) caveolin   KO K06278   caveolin 1 Organism sko  Saccoglossus kowalevskii (acorn worm) Pathway sko04144   Endocytosis sko05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sko00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100313571  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     100313571  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sko04131]     100313571 Membrane trafficking [BR:sko04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     100313571 SSDB OrthologParalogGFIT Motif Pfam:  Caveolin Interfer-bind Motif Other DBs NCBI-GeneID:  100313571 NCBI-ProteinID:  NP_001161512 UniProt:  D1LWY1 A0ABM0GG58 LinkDB All DBs Position Unknown AA seq 156 aa AA seqDB search MMADEPQMNVERSGDDIEVKIKAPSGEHLDMDDRDPTKMNEFVRVAFEEVFAEPEGMHSF DAIWRYAFITFTGVKFWCYRITTCICGIPCAVCWGIEFACLTFWHVWYVVPYTKAWLISI NWLQRLWQIWISCFMDPLFDSFSRIFSNIKVTVNRD NT seq 134 nt NT seq  +upstreamnt  +downstreamnt atgatggcagatgaaccgcagatgaacgtggaacggtcgggggatgacatcgaggtgaaa atcaaggcaccgagtggagaacacctagatatggacgacagagatcccacgaaaatgaat gaattcgtgagggt

DBGET integrated database retrieval system