Saccoglossus kowalevskii (acorn worm): 100369336 Help Entry 100369336         CDS       T04123                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism sko  Saccoglossus kowalevskii (acorn worm) Pathway sko04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:sko00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     100369336  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sko01009]     100369336   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sko04131]     100369336    03036 Chromosome and associated proteins [BR:sko03036]     100369336   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sko04147]     100369336 Protein phosphatases and associated proteins [BR:sko01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100369336 Membrane trafficking [BR:sko04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100369336 Chromosome and associated proteins [BR:sko03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100369336 Exosome [BR:sko04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100369336 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 Dockerin_1 EH EFhand_Ca_insen SPARC_Ca_bdg EF_EFCAB10_C AIF-1 EF-hand_11 ATP-cone DUF5580_M MotA_activ DUF1002 RNA_pol_Rpb4 Motif Other DBs NCBI-GeneID:  100369336 NCBI-ProteinID:  XP_002737577 LinkDB All DBs Position Un AA seq 81 aa AA seqDB search MGCGGSSEPPDERISEQEIYEAFRAMDIDGSGTISAEELREVVKRLGEDLTEDDIQEMVE LVDENGDGEIDYGEFVKIMRS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgggctgtggaggtagttctgaaccacctgatgagcgtatttctgaacaagaaatctac gaggctttccgcgctatggacattgatggcagtggcacaatcagcgcagaagaactcagg gaggtggtgaagcgactgggagaagacctaacggaagatgatatacaggaaatggtcgaa cttgttgatgaaaacggagacggagaaatcgattatggggaattcgttaaaattatgaga agttaa

DBGET integrated database retrieval system