Saccoglossus kowalevskii (acorn worm): 100374593 Help Entry 100374593         CDS       T04123                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism sko  Saccoglossus kowalevskii (acorn worm) Pathway sko04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:sko00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     100374593  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sko01009]     100374593   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sko04131]     100374593    03036 Chromosome and associated proteins [BR:sko03036]     100374593   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sko04147]     100374593 Protein phosphatases and associated proteins [BR:sko01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100374593 Membrane trafficking [BR:sko04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100374593 Chromosome and associated proteins [BR:sko03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100374593 Exosome [BR:sko04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100374593 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_9 DUF5580_M AIF-1 DUF6537 SAPC2_N SPEF2_C EF-hand_11 Motif Other DBs NCBI-GeneID:  100374593 NCBI-ProteinID:  XP_002739600 UniProt:  A0ABM0GXL0 LinkDB All DBs Position Un AA seq 121 aa AA seqDB search MRSLGTHPTTVELNAYLKQYDKGDGKIHFDDFLVMMHKQLKSEDPAREILDAFRKTDRQN RGFIMAKEFKHIMKSFGEKLTTREVDEILREAGIPQNGFVKYEEFVRIFLRPIPDSILPP A NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgcgatcactaggaacacatccgactaccgttgaattgaatgcatatcttaaacagtat gacaaaggtgacggtaagatccactttgatgatttcctggtaatgatgcataagcagctg aagtcagaagatcctgccagagagatactggatgctttcagaaaaacagacagacagaac agagggtttataatggctaaagagttcaaacatattatgaaaagttttggagagaaatta acaactagagaagtggacgaaattctcagagaggctggaattccacaaaatggatttgtt aaatatgaagaatttgtacggatatttttgagacctattccagactcaatcctcccacct gcttga

DBGET integrated database retrieval system