Saccoglossus kowalevskii (acorn worm): 100377418 Help Entry 100377418         CDS       T04123                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism sko  Saccoglossus kowalevskii (acorn worm) Pathway sko04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:sko00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     100377418  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sko04121]     100377418    03400 DNA repair and recombination proteins [BR:sko03400]     100377418 Ubiquitin system [BR:sko04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      100377418    Cul5 complex      100377418 DNA repair and recombination proteins [BR:sko03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      100377418 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  100377418 NCBI-ProteinID:  XP_002734124 UniProt:  A0ABM0GNX3 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search MDVFLMIRRKKSTIFTDAKETTTVYELKKIVEGITKRPPEDQRLHKDELILEDTKTLGDC GFTSSTARAQAPATVGLAFKEGEEDFEPLEVTPYSNPPELPDVMKPQESSTSNAAEQPVS NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttttgatgatccgtcgtaagaaaagtaccatcttcactgatgccaaagaa acaacaaccgtatacgagttaaagaaaatagtagaaggcatcactaagagaccacctgaa gaccaacgattacataaagatgagctgattctagaagacacaaaaacattgggggattgt ggttttactagcagtactgctagagcacaggcaccagcaacagtaggattagcctttaaa gaaggagaggaagattttgaaccactggaagttacaccatactccaatccaccagagtta ccagatgttatgaaaccacaagaatctagtacatcaaatgcagcagaacagccagtctct taa

DBGET integrated database retrieval system