Saccoglossus kowalevskii (acorn worm): 100378148 Help Entry 100378148         CDS       T04123                                  Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism sko  Saccoglossus kowalevskii (acorn worm) Pathway sko04144   Endocytosis sko05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sko00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100378148  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     100378148  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sko04131]     100378148    03036 Chromosome and associated proteins [BR:sko03036]     100378148   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sko04147]     100378148    04031 GTP-binding proteins [BR:sko04031]     100378148 Membrane trafficking [BR:sko04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     100378148  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     100378148   Macropinocytosis    Ras GTPases     100378148 Chromosome and associated proteins [BR:sko03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     100378148 Exosome [BR:sko04147]  Exosomal proteins   Exosomal proteins of microglial cells    100378148   Exosomal proteins of breast milk    100378148 GTP-binding proteins [BR:sko04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     100378148 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  100378148 NCBI-ProteinID:  XP_006825688 LinkDB All DBs Position Un AA seq 147 aa AA seqDB search MSILKCVVIGDGAVGKTCMLMSYATNRFPADHVPTVFDNYAVNLTIGGDTYDVLGLFDTA GHKYVPEIKCHCPKTPFLLVGTQIDRRAEYTDGSYQGKPIMFVQGVKAAKSLGAEMYVEC SALTQQGLKNVFDESILTVLNPHKKKR NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgagcattttaaaatgtgtggtaatcggtgatggcgctgtgggcaaaacgtgtatgctg atgagttatgccacaaacagatttcccgcagatcatgtgccgacagttttcgacaattat gcagtgaatttgacaataggtggagacacgtatgatgtgctaggattgtttgacacggcg ggacacaaatatgttccagaaattaaatgtcactgtccgaagaccccatttctcctcgtt ggtacgcaaattgacagaagggctgaatacacggatggcagttatcaaggcaaacccatc atgtttgtgcaaggtgtcaaagccgcgaaatcgctgggagcggagatgtatgtggagtgc tcagcgcttacacaacaaggacttaaaaatgtgtttgatgaatccatcctgacagtttta aatcctcacaaaaagaagcggtaa

DBGET integrated database retrieval system