Saccoglossus kowalevskii (acorn worm): 102805018 Help Entry 102805018         CDS       T04123                                  Name (RefSeq) uncharacterized LOC102805018   KO K02183   calmodulin Organism sko  Saccoglossus kowalevskii (acorn worm) Pathway sko04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:sko00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     102805018  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sko01009]     102805018   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sko04131]     102805018    03036 Chromosome and associated proteins [BR:sko03036]     102805018   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sko04147]     102805018 Protein phosphatases and associated proteins [BR:sko01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102805018 Membrane trafficking [BR:sko04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102805018 Chromosome and associated proteins [BR:sko03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102805018 Exosome [BR:sko04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102805018 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_11 EF-hand_8 EF-hand_6 DUF2284 AIF-1 ADSL_C Motif Other DBs NCBI-GeneID:  102805018 NCBI-ProteinID:  XP_006819971 LinkDB All DBs Position Un AA seq 124 aa AA seqDB search MEFNFHALRMGFEHFDHTGVGVVSKMDFHNVMNEYDFKMTRHECNRLIERCSVTTSDGNV NYKEFLLKFMSRSERDLAHRVISDPCHKFNTRAFTPPGALSIQDVEAKLVEYFHKEFLQL LGSL NT seq 373 nt NT seq  +upstreamnt  +downstreamnt atggagtttaattttcatgctcttcgcatgggctttgagcactttgatcatactggtgta ggagttgtctctaaaatggattttcacaatgttatgaatgaatatgatttcaaaatgaca aggcatgagtgtaaccgtctaattgaaaggtgttctgtgacaacctcagatggtaatgtt aactacaaagaatttctcctgaaatttatgtcaagatctgaaagagatttggctcacaga gttatatcagacccttgtcacaaatttaacacacgtgcattcactccacctggtgcactc tccattcaagacgtagaagctaaacttgtggaatattttcataaagagtttctacaatta cttggatctctaa

DBGET integrated database retrieval system