Sphingomonas koreensis: BRX40_13080 Help Entry BRX40_13080       CDS       T04828                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism skr  Sphingomonas koreensis Pathway skr01100   Metabolic pathways skr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:skr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BRX40_13080    00074 Mycolic acid biosynthesis     BRX40_13080   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BRX40_13080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  APR53234 UniProt:  A0A1L6JBD3 LinkDB All DBs Position 2719033..2719269 Genome browser AA seq 78 aa AA seqDB search MSETADRVKKIVVEHLGVEAEKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVKDAITYIDENQG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccgccgatcgcgtgaagaagatcgtcgtcgagcacctcggcgtcgaagcc gaaaaggtgaccgaggacgcgagcttcatcgacgacctgggcgcggacagcctcgacatc gtcgagctggtgatggcgttcgaagaggaattcggcgtcgagatccccgatgatgccgcc gagaagatcacgaccgtcaaggacgcgatcacctatatcgacgagaatcagggctaa

DBGET integrated database retrieval system