Sphingomonas koreensis: BRX40_17500 Help Entry BRX40_17500       CDS       T04828                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism skr  Sphingomonas koreensis Pathway skr00190   Oxidative phosphorylation skr01100   Metabolic pathways skr02020   Two-component system Module skr_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:skr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BRX40_17500  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BRX40_17500 Enzymes [BR:skr01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BRX40_17500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  APR53966 UniProt:  A0A1L6JDG1 LinkDB All DBs Position 3647289..3647414 Genome browser AA seq 41 aa AA seqDB search MWYFTWVLGLGLAVGFGIINGLWHEFHLPVDDGEPFGADEA NT seq 126 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcacctgggtattgggcctcgggctcgcggtcgggttcggcatcatcaac ggcttgtggcacgagttccacctgccggtggacgacggcgagccgttcggcgccgacgag gcctga

DBGET integrated database retrieval system