Salinivibrio kushneri: FCN78_08235 Help Entry FCN78_08235       CDS       T05956                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sks  Salinivibrio kushneri Pathway sks01100   Metabolic pathways sks01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sks00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FCN78_08235 (acpP)    00074 Mycolic acid biosynthesis     FCN78_08235 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FCN78_08235 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 EutQ Motif Other DBs NCBI-ProteinID:  QCP02377 LinkDB All DBs Position 1:complement(1740930..1741166) Genome browser AA seq 78 aa AA seqDB search MSNIEERVKKIIVEQLGVDEAEVKNEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVVGASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgcgtaaagaaaatcatcgttgagcaactaggtgtcgacgaa gcagaagtgaaaaacgaagcttcattcgtagacgacttgggcgcggactctctggatacc gttgagctggtaatggctcttgaagaggaattcgatacagagattccagatgaagaagca gagaagattaccactgtacaggcagccatcgactacgttgtcggcgcttcagcgtaa

DBGET integrated database retrieval system