KEGG   Sulfuricurvum kujiense: Sulku_1236
Entry
Sulku_1236        CDS       T01370                                 
Name
(GenBank) Phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
sku  Sulfuricurvum kujiense
Pathway
sku00770  Pantothenate and CoA biosynthesis
sku01100  Metabolic pathways
sku01240  Biosynthesis of cofactors
Module
sku_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:sku00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Sulku_1236
Enzymes [BR:sku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     Sulku_1236
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: ADR33899
UniProt: E4TXJ0
LinkDB
Position
complement(1245739..1246230)
AA seq 163 aa
MHKIALYPGTFDPITNGHFDIIERGIRLFDEVIIAVADSQEKKPMFTLQERVDMVKLAVR
DLERVTVVGFDNLTVELANTLGATVLIRGLRAVSDFEFELQLGYLNNSLDPNIETVYLMP
KLKHAFISSSIVRNLLKFNGKTEHLLPSPVQDVIGSMKSCTLR
NT seq 492 nt   +upstreamnt  +downstreamnt
atgcataagatcgccctttatcccggaactttcgatcccattaccaacggccatttcgat
attatcgagcggggaatacgtctctttgatgaagtcatcatcgccgtcgccgattcacag
gaaaaaaaaccgatgttcacgttgcaagaacgggtggacatggttaagctggccgttaga
gatttagagcgggtaacggttgtcggatttgacaatctcacggtagaacttgccaatacg
ctcggagctaccgtattgatacgggggcttcgcgccgtcagcgatttcgaatttgaactg
cagttgggatatctgaataactcgcttgatccgaatattgaaacggtttatttgatgccg
aaactcaaacacgcatttatcagttcctccatcgtccggaatctgctgaaatttaacggt
aaaacggagcatcttctcccctcgccggttcaagatgtcatcgggagcatgaaatcatgt
acattgcgatag

DBGET integrated database retrieval system