Sphaerospermopsis kisseleviana: NIES73_38710 Help Entry NIES73_38710      CDS       T10228                                  Symbol acp Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism skv  Sphaerospermopsis kisseleviana Pathway skv01100   Metabolic pathways skv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:skv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NIES73_38710 (acp)    00074 Mycolic acid biosynthesis     NIES73_38710 (acp)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NIES73_38710 (acp) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  BAZ82588 LinkDB All DBs Position 4207791..4208036 Genome browser AA seq 81 aa AA seqDB search MNQEIFKLVKKVIVDQLEVDEEKVVPNASFTDDLGADSLDIVELVMAFEEEFDIEIPDEA AEKILTVQEVVDYIEKNAPSD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatcaagaaatttttaaactggttaaaaaagttatcgtcgatcaactagaggttgat gaggagaaagttgtacccaacgcctcatttacagatgatttaggcgctgattccttggat attgtggaactggtaatggcttttgaagaagaatttgatattgaaattcccgatgaagcc gccgaaaagattttaacggttcaagaggtagtagattacatcgagaaaaacgctccttct gactga

DBGET integrated database retrieval system