Streptomyces koyangensis: D0C37_22630 Help Entry D0C37_22630       CDS       T06436                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism sky  Streptomyces koyangensis Pathway sky00020   Citrate cycle (TCA cycle) sky00720   Other carbon fixation pathways sky01100   Metabolic pathways sky01110   Biosynthesis of secondary metabolites sky01120   Microbial metabolism in diverse environments sky01200   Carbon metabolism sky01210   2-Oxocarboxylic acid metabolism Module sky_M00009   Citrate cycle (TCA cycle, Krebs cycle) sky_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:sky00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     D0C37_22630   09102 Energy metabolism    00720 Other carbon fixation pathways     D0C37_22630 Enzymes [BR:sky01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      D0C37_22630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  AXQ57122 UniProt:  A0A385DF59 LinkDB All DBs Position complement(5036651..5036905) Genome browser AA seq 84 aa AA seqDB search MTGYLCPGCRIEQHRACTGNNDWYMAGYGTPAVRTRCACPCCPQEVRGVCDRCGGPCDPQ TAVEHRTCRPAADATRHTPTEVIR NT seq 255 nt NT seq  +upstreamnt  +downstreamnt gtgaccggctacctctgccccggctgccgcatcgagcagcatcgcgcctgcacgggcaac aacgactggtacatggccggctacggcacgcccgccgtccggacccggtgcgcctgcccc tgctgtccgcaggaggtacgcggggtctgcgaccggtgcggcggaccgtgcgacccgcag accgccgtcgagcaccgcacctgccgacccgccgccgacgccacccgccatacccccacg gaggtcatccgatga

DBGET integrated database retrieval system