Serpula lacrymans: SERLADRAFT_376584 Help Entry SERLADRAFT_376584 CDS       T03135                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism sla  Serpula lacrymans Pathway sla03060   Protein export sla04141   Protein processing in endoplasmic reticulum sla04145   Phagosome Brite KEGG Orthology (KO) [BR:sla00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SERLADRAFT_376584    04141 Protein processing in endoplasmic reticulum     SERLADRAFT_376584  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     SERLADRAFT_376584  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sla04131]     SERLADRAFT_376584   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:sla02044]     SERLADRAFT_376584 Membrane trafficking [BR:sla04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     SERLADRAFT_376584 Secretion system [BR:sla02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    SERLADRAFT_376584 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE TBP-TOTE Motif Other DBs NCBI-GeneID:  18810651 NCBI-ProteinID:  XP_007312930 JGI:  376584 UniProt:  F8NG76 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search MSEKFKEFIEVPQQFIHDGNQFITRCTKPSQKEFTQISKAVATGFVVMGFIGYLVKLIHI PINNILVGGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtctgaaaaattcaaggaattcattgaggtccctcaacagttcatccacgatggaaac cagttcataacacgttgcacgaaaccaagtcaaaaggaattcactcaaatatccaaggct gttgctactggcttcgttgtaatgggattcatcgggtatcttgtgaaactgatccatatt cctataaataatatccttgtgggaggcgcataa

DBGET integrated database retrieval system