Serpula lacrymans: SERLADRAFT_382078 Help Entry SERLADRAFT_382078 CDS       T03135                                  Name (RefSeq) hypothetical protein   KO K21751   down-regulator of transcription 1 Organism sla  Serpula lacrymans Brite KEGG Orthology (KO) [BR:sla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:sla03021]     SERLADRAFT_382078    03036 Chromosome and associated proteins [BR:sla03036]     SERLADRAFT_382078 Transcription machinery [BR:sla03021]  Eukaryotic type   RNA polymerase II system    Other transcription-related factors     Others      SERLADRAFT_382078 Chromosome and associated proteins [BR:sla03036]  Eukaryotic type   Histone modification proteins    HAT complexes     ATAC complex      SERLADRAFT_382078 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Ssb-like_OB Motif Other DBs NCBI-GeneID:  18810983 NCBI-ProteinID:  XP_007315466 JGI:  382078 UniProt:  F8NMH8 LinkDB All DBs Position Unknown AA seq 71 aa AA seqDB search MSDREGHSGGTGGPDEDLSLPKATVAKMISELLPSDITCAKETRDLIIECCVGEHTQSFT SSRRNASVDFF NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgtcagaccgcgaaggacactctggggggacaggtgggccagatgaagatttgtctctg ccaaaggcgactgtagccaagatgataagcgagctactaccaagtgatattacatgtgct aaagaaacgcgcgatctgatcatagaatgctgtgtaggtgaacatactcaaagtttcaca tcatctcgtcgcaatgccagtgttgacttcttttaa

DBGET integrated database retrieval system