Serpula lacrymans: SERLADRAFT_390420 Help Entry SERLADRAFT_390420 CDS       T03135                                  Name (RefSeq) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism sla  Serpula lacrymans Pathway sla03050   Proteasome sla03440   Homologous recombination Brite KEGG Orthology (KO) [BR:sla00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     SERLADRAFT_390420   09124 Replication and repair    03440 Homologous recombination     SERLADRAFT_390420  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sla03019]     SERLADRAFT_390420    04131 Membrane trafficking [BR:sla04131]     SERLADRAFT_390420    03051 Proteasome [BR:sla03051]     SERLADRAFT_390420    03400 DNA repair and recombination proteins [BR:sla03400]     SERLADRAFT_390420 Messenger RNA biogenesis [BR:sla03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      SERLADRAFT_390420 Membrane trafficking [BR:sla04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     SERLADRAFT_390420 Proteasome [BR:sla03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      SERLADRAFT_390420 DNA repair and recombination proteins [BR:sla03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      SERLADRAFT_390420 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DSS1_SEM1 Motif Other DBs NCBI-GeneID:  18811435 NCBI-ProteinID:  XP_007318743 JGI:  390420 UniProt:  F8NXQ2 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MSSSASTSKVPEETKKPEEQTKEENTQPHLGSLEEDDEFEEFATADWDDSQTDLVHLNGT APGAAKSGGDKLWEDNWDDDDIEEEFSVQLRNELTKSSGGSGEAMQH NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgtcctcttcagcatctacctccaaagtgccagaggagaccaaaaagcctgaagagcag acgaaagaggagaatacgcagcctcatcttggcagtctcgaggaggatgacgagtttgag gaattcgctactgcagactgggatgattctcaaactgatctggttcacctaaatggcact gctccgggagctgccaagtcgggaggagataagctttgggaggacaactgggacgacgac gacatcgaggaggaattcagcgtacagctaagaaatgagctcacaaaatcgagcggggga agtggcgaggcaatgcagcattga

DBGET integrated database retrieval system