Sphingorhabdus lacus: EUU25_09875 Help Entry EUU25_09875       CDS       T09898                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slaa  Sphingorhabdus lacus Pathway slaa01100   Metabolic pathways slaa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slaa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EUU25_09875    00074 Mycolic acid biosynthesis     EUU25_09875   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EUU25_09875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  QGY80898 UniProt:  A0A6I6L8Q9 LinkDB All DBs Position 2102975..2103208 Genome browser AA seq 77 aa AA seqDB search MSDTADRVKKIVVEHLGVEADKVTEAASFIDDLGADSLDIVELVMAFEEEFNVEIPDDAA EKIATVKDAIDFINANG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtgataccgcggatcgggtcaaaaagatcgttgtagaacatttgggtgttgaagcc gacaaggttaccgaagcagccagctttatcgacgatctcggcgctgacagtctcgacatc gtcgaactcgtcatggcgttcgaagaagaatttaacgtggaaatccccgacgatgcggct gaaaagatcgcgaccgtcaaggatgccatcgactttatcaacgccaacggttga

DBGET integrated database retrieval system