KEGG   Sulfurimicrobium lacus skT11: SKTS_06760
Entry
SKTS_06760        CDS       T06796                                 
Symbol
nuoJ
Name
(GenBank) NADH dehydrogenase subunit J
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
slac  Sulfurimicrobium lacus skT11
Pathway
slac00190  Oxidative phosphorylation
slac01100  Metabolic pathways
Module
slac_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:slac00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SKTS_06760 (nuoJ)
Enzymes [BR:slac01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     SKTS_06760 (nuoJ)
SSDB
Motif
Pfam: Oxidored_q3 AveC_like DUF6057 DUF3290 TrbK
Other DBs
NCBI-ProteinID: BCB25790
UniProt: A0A6F8V8Z7
LinkDB
Position
683491..684141
AA seq 216 aa
MNFETIIFYLFAAILVFAAARVVTARNPVHSALFLVLAFFTAAALWITLEAEFLAITLVL
VYVGAVMVLFLFVVMMLDINYDLLREGFWENFPYALTVAILMGAEMVLVLAGRNFWANGN
GGMPNAHGAGYSNIKELGRLIYTDYVYPFEIASVILLVAIVAAIALTLRHRKDTKYQDPA
AQIAVRRNDRLRIIAVSSDNKLKQQAAEDSPSAEQP
NT seq 651 nt   +upstreamnt  +downstreamnt
atgaattttgaaacaataatattttatctctttgcggcgatcctggtgtttgccgcagca
cgcgtggtgaccgcgcgtaacccggtgcattccgccctgtttctggtgctggcttttttt
accgctgccgccctgtggattacgctggaggctgagttcctggcaatcacgctggtgctg
gtgtacgtgggtgctgtgatggtgttgttcctgttcgtggtgatgatgctcgatatcaac
tacgacctgctacgcgaaggtttctgggagaattttccctacgcgctgacggtggcgata
ttgatgggcgcggaaatggtactggtactggccggacgcaatttctgggcgaacggcaac
ggcggcatgccgaacgcgcatggcgcgggttatagcaatatcaaggaattgggccgcctg
atttataccgactacgtctacccgttcgagatcgcctcggtcattttgctggtggcgatc
gttgcggccatcgcgcttacgctgcgccaccgcaaagataccaaatatcaggacccggcc
gcacagatcgcggtgcgtcgtaacgatcgtttgcgcatcatcgcggtttcgtcggataac
aagttgaaacaacaggcggcagaagacagcccgtcggcagagcaaccttga

DBGET integrated database retrieval system