Sulfurimicrobium lacus skT11: SKTS_19890 Help Entry SKTS_19890        CDS       T06796                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slac  Sulfurimicrobium lacus skT11 Pathway slac01100   Metabolic pathways slac01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slac00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SKTS_19890 (acpP)    00074 Mycolic acid biosynthesis     SKTS_19890 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SKTS_19890 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  BCB27103 UniProt:  A0A6F8VB86 LinkDB All DBs Position 2038855..2039091 Genome browser AA seq 78 aa AA seqDB search MSDIELRVKKIVAEQLGVNEAEVKIESSFVDDLGADSLDTVELVMALEEEFDCEIPDEEA EKITTVKQAVDYINAHPK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaactgcgtgttaagaaaattgtggccgagcagctgggcgtgaatgaa gctgaagtcaaaatcgagtcctccttcgtggacgatctcggtgcggactccctcgacacc gtggaactggtgatggcgctggaagaagaattcgactgcgaaatccctgatgaagaagcc gaaaagatcaccaccgtgaaacaggctgttgattacatcaacgcccaccccaagtaa

DBGET integrated database retrieval system