Silene latifolia (white campion): 141599544
Help
Entry
141599544 CDS
T11116
Name
(RefSeq) SKP1-like protein 1A
KO
K03094
S-phase kinase-associated protein 1
Organism
slaf Silene latifolia (white campion)
Pathway
slaf03083
Polycomb repressive complex
slaf04120
Ubiquitin mediated proteolysis
slaf04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
slaf00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
141599544
04120 Ubiquitin mediated proteolysis
141599544
09126 Chromosome
03083 Polycomb repressive complex
141599544
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
slaf04131
]
141599544
04121 Ubiquitin system [BR:
slaf04121
]
141599544
03036 Chromosome and associated proteins [BR:
slaf03036
]
141599544
Membrane trafficking [BR:
slaf04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
141599544
Ubiquitin system [BR:
slaf04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
141599544
Cul7 complex
141599544
Chromosome and associated proteins [BR:
slaf03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
141599544
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
141599544
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1_POZ
Skp1
Motif
Other DBs
NCBI-GeneID:
141599544
NCBI-ProteinID:
XP_074275680
LinkDB
All DBs
Position
9:34425558..34430020
Genome browser
AA seq
203 aa
AA seq
DB search
MAAAIEGSSSSTATETMATAIEVSSSPTATEAMAAAIELSLSSGATETKKIVLKSSDDEE
FEVEEAVALQSQTIKHMIEDDCADNAIPLPNITAYILDKVIEYCEKHVEASYTYTPSDTT
SPADQLKKWDAEFAKVDQDTLFDIMLAANYLNIKGLLDLTCQTVANMMKGKTPEEIRETF
HIINDYTPEEEEEVRRGIQWAFE
NT seq
612 nt
NT seq
+upstream
nt +downstream
nt
atggcggctgcaattgaaggctcatcgtcttcaactgcaacagaaacaatggcgaccgca
attgaagtatcatcgtctccaactgcaacagaagcaatggcggccgcaattgaattatca
ttgtcttcaggtgcaacagaaacaaagaaaatcgtgctgaaatcatcagatgacgaggag
ttcgaggtggaagaggcagttgcattacaatctcaaacaatcaaacacatgattgaagat
gattgtgctgataacgcaatcccacttcctaatattactgcatacatattagataaggta
attgagtactgtgaaaagcatgttgaagcttcatatacttatactccttcggatactact
tctcctgctgatcaacttaagaaatgggatgctgaatttgctaaagtcgatcaggatact
ctctttgatattatgttggctgctaattatctgaacatcaagggtttactggacttgaca
tgccaaacagtagcgaacatgatgaaaggaaaaaccccagaggaaatcagggagacattc
cacatcattaatgactacaccccggaggaggaggaagaagtgaggagggggatccagtgg
gcttttgaatga
DBGET
integrated database retrieval system