Silene latifolia (white campion): 141610867 Help Entry 141610867         CDS       T11116                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism slaf  Silene latifolia (white campion) Brite KEGG Orthology (KO) [BR:slaf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:slaf03041]     141610867   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:slaf04052]     141610867 Spliceosome [BR:slaf03041]  Complex B   Other components    Complex B specific factors     141610867 Cytokines and neuropeptides [BR:slaf04052]  Neuropeptides   Unclassified    141610867 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Ubiquitin_4 Rad60-SLD Motif Other DBs NCBI-GeneID:  141610867 NCBI-ProteinID:  XP_074285258 LinkDB All DBs Position 11:complement(7544060..7544610) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLRDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggtattgaacgatcgtctgggcaagaaagttcgagtcaagtgcaacgat gatgacaccattggagatctgaagaaacttgttgctgctcaaactggtactcgtgctgat aagattcgtatccaaaagtggtacaatatctacaaggatcatattactcttcgcgattac gagattcatgatggcatgggtcttgaactctactacaactag

DBGET integrated database retrieval system