Silene latifolia (white campion): 141646413
Help
Entry
141646413 CDS
T11116
Name
(RefSeq) SKP1-like protein 1A
KO
K03094
S-phase kinase-associated protein 1
Organism
slaf Silene latifolia (white campion)
Pathway
slaf03083
Polycomb repressive complex
slaf04120
Ubiquitin mediated proteolysis
slaf04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
slaf00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
141646413
04120 Ubiquitin mediated proteolysis
141646413
09126 Chromosome
03083 Polycomb repressive complex
141646413
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
slaf04131
]
141646413
04121 Ubiquitin system [BR:
slaf04121
]
141646413
03036 Chromosome and associated proteins [BR:
slaf03036
]
141646413
Membrane trafficking [BR:
slaf04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
141646413
Ubiquitin system [BR:
slaf04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
141646413
Cul7 complex
141646413
Chromosome and associated proteins [BR:
slaf03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
141646413
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
141646413
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Motif
Other DBs
NCBI-GeneID:
141646413
NCBI-ProteinID:
XP_074310411
LinkDB
All DBs
Position
3:145258808..145260530
Genome browser
AA seq
169 aa
AA seq
DB search
MAETTTSKKIMLKSSDGEDFEVDEIVALESQTIKHMIEDECADNAIPLPNVTAKTLSKVI
EYCKKHVDAAAAKTADTATTSTFGVAGGDDELKKWDEEFMKVDQNTLFDICLAANYLNIK
SLLELTCQTVAEMIKNMTPEEVRKVFNITNDFTPEEEAEIRKEHQWAFE
NT seq
510 nt
NT seq
+upstream
nt +downstream
nt
atggcggaaacaacaacatcaaagaagatcatgttaaaatcatcagacggcgaggatttc
gaagtggacgagattgtggcgttggaatctcaaacaataaagcatatgattgaagatgaa
tgtgctgacaatgcaattcctcttcctaatgttactgctaaaacattgtctaaggttatc
gagtattgtaagaaacatgtcgatgctgccgctgcgaaaaccgctgatacagcaacaact
agtacctttggggttgctggaggtgatgatgaacttaagaagtgggatgaggaatttatg
aaagttgaccaaaataccctttttgatatctgcttggcagctaattatctgaacatcaag
agtctcctggagttgacctgccaaacggtggccgaaatgatcaaaaatatgacaccagag
gaagtcaggaaggtattcaacattacaaacgacttcaccccggaagaagaagcggagatt
agaaaggagcaccagtgggcctttgaatga
DBGET
integrated database retrieval system