Streptomyces laculatispora: P8A22_27105 Help Entry P8A22_27105       CDS       T09657                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slai  Streptomyces laculatispora Pathway slai00998   Biosynthesis of various antibiotics slai01100   Metabolic pathways slai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slai00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P8A22_27105    00074 Mycolic acid biosynthesis     P8A22_27105   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P8A22_27105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  WLQ43260 LinkDB All DBs Position complement(6107896..6108144) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVTGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAADYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcaggaagagatcgtcaccggtctcgccgagatcgtcaacgagatcgcc ggtatcccggtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtcaagatcccc gacgaggacgtcaagaacctcaagacggtcggcgacgctgccgactacatcctcaagcac caggcctga

DBGET integrated database retrieval system