Sphingomonas lacunae: GV829_02090 Help Entry GV829_02090       CDS       T07071                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slan  Sphingomonas lacunae Pathway slan01100   Metabolic pathways slan01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slan00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GV829_02090    00074 Mycolic acid biosynthesis     GV829_02090   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GV829_02090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QJQ31385 UniProt:  A0A6M4AQT0 LinkDB All DBs Position 459137..459379 Genome browser AA seq 80 aa AA seqDB search MSDRTATAQAIHAQIEPFNKKGIDVTDATTFAGDLEWDSLTVMDFVAAIEDEFDIIITMN MQAEIETVGQLIDAVDKLKG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtccgaccgcactgccaccgctcaggcgattcacgcgcagatcgagccgttcaacaaa aagggcatcgacgtcactgacgcgacgacctttgctggcgaccttgagtgggacagcctc accgtgatggatttcgttgcagcgatcgaagatgagttcgacatcatcatcaccatgaac atgcaggccgaaatcgagactgttggccagttgatcgacgccgtcgacaagctcaagggc tga

DBGET integrated database retrieval system