Sphingomonas lacunae: GV829_10710 Help Entry GV829_10710       CDS       T07071                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism slan  Sphingomonas lacunae Pathway slan00190   Oxidative phosphorylation slan01100   Metabolic pathways Module slan_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:slan00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     GV829_10710  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:slan00194]     GV829_10710 Photosynthesis proteins [BR:slan00194]  Photosystem and electron transport system   F-type ATPase [OT]    GV829_10710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C SP_C-Propep Motif Other DBs NCBI-ProteinID:  QJQ32855 UniProt:  A0A6M4AUR5 LinkDB All DBs Position 2231103..2231330 Genome browser AA seq 75 aa AA seqDB search MDAEAAKLIGAGLAAIGAGVAALGVGNVFGSFLESALRNPAAADGQQGRLFIGFAAAELL GLLAFVVAMILLFVV NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggatgcagaagcagcaaagctgatcggtgccggcctggccgccattggtgccggcgtc gccgcgcttggcgtgggtaacgtcttcggctcgttcctcgaaagcgccctgcgcaacccg gctgccgctgacggccagcagggtcgcctgttcatcggcttcgccgctgccgaacttctc ggcctgctggcgttcgtcgttgcgatgatccttctcttcgtcgtctga

DBGET integrated database retrieval system