Streptococcus lactarius: J4854_00285 Help Entry J4854_00285       CDS       T07623                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slat  Streptococcus lactarius Pathway slat01100   Metabolic pathways slat01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slat00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J4854_00285    00074 Mycolic acid biosynthesis     J4854_00285   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J4854_00285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Toxin_10 DUF1493 Motif Other DBs NCBI-ProteinID:  QUB38941 UniProt:  A0A9X0WLV2 LinkDB All DBs Position 36626..36874 Genome browser AA seq 82 aa AA seqDB search MSKQNEILATIEEFLKDRKGSDFQVSLESDLRKDLQADSVELMEFIIELEDEYQLEIPDK VIDEFNTVGDVVDYIEKRTAGH NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagtaaacaaaacgaaattttagctactattgaggaatttctcaaagaccgcaaggga tcagattttcaagtatctttggaatctgacttacgtaaggatttacaagcggattctgtt gaattgatggaatttatcatcgagttggaagatgaataccaattggaaatcccagataag gtgattgatgaattcaatacggttggggatgttgtagattatattgaaaaacgaactgct ggtcactaa

DBGET integrated database retrieval system