Sugiyamaella lignohabitans: AWJ20_2632 Help Entry AWJ20_2632        CDS       T05270                                  Symbol CDC42 Name (RefSeq) Rho family GTPase CDC42   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism slb  Sugiyamaella lignohabitans Pathway slb04145   Phagosome slb04148   Efferocytosis slb04620   Toll-like receptor signaling pathway slb05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:slb00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     AWJ20_2632 (CDC42)    04148 Efferocytosis     AWJ20_2632 (CDC42)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     AWJ20_2632 (CDC42)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     AWJ20_2632 (CDC42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:slb04131]     AWJ20_2632 (CDC42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:slb04147]     AWJ20_2632 (CDC42)    04031 GTP-binding proteins [BR:slb04031]     AWJ20_2632 (CDC42) Membrane trafficking [BR:slb04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     AWJ20_2632 (CDC42)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     AWJ20_2632 (CDC42)   Macropinocytosis    Ras GTPases     AWJ20_2632 (CDC42)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     AWJ20_2632 (CDC42) Exosome [BR:slb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    AWJ20_2632 (CDC42)   Exosomal proteins of other body fluids (saliva and urine)    AWJ20_2632 (CDC42)   Exosomal proteins of colorectal cancer cells    AWJ20_2632 (CDC42)   Exosomal proteins of bladder cancer cells    AWJ20_2632 (CDC42) GTP-binding proteins [BR:slb04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     AWJ20_2632 (CDC42) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  30034565 NCBI-ProteinID:  XP_018737489 UniProt:  A0A167F9W5 LinkDB All DBs Position B:complement(2003247..2003825) Genome browser AA seq 192 aa AA seqDB search MQSIKCVVTGDGAVGKTCMLISYTTNAFPGEYIPTVFDNYSATVIVDSQPINLGLWDTAG QEDYDRLRPLSYPQTGVFLICFSLVSPASFENVKTKWHPEITHHAPNTPTILVGTKLDLR EDRETIDKLQEKRQSPVTYSQGLQMAKDIGAVKYLECSALTQKGLKAVFDEAIHAVLSPP VVKKKQKKCVIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaaagcataaaatgtgtcgtcaccggagacggtgctgtgggtaaaacctgtatgctg atttcctacacaaccaatgcattccctggagagtacatccccactgtcttcgacaactat tcagccacagttattgtggactcacaaccaatcaacctgggtttatgggatactgcaggc caagaagactacgaccgtctacggccgttatcatacccacaaacaggcgtgtttcttatc tgtttctcgctggtgagtcctgcatctttcgagaacgtcaagaccaaatggcaccccgaa atcacccaccacgctcctaacacacctaccattcttgtaggcaccaaactagacctgcga gaagaccgcgagacgattgacaagctacaagaaaagcgccagtcacccgtaacatactcg caaggactacaaatggccaaggatattggcgctgtgaaatacctggaatgctctgcactg acacagaagggactaaaagcggtgttcgacgaggccatacacgcggtcctgtcaccgcca gtagtcaagaagaagcagaagaaatgtgttattttgtag

DBGET integrated database retrieval system