Sugiyamaella lignohabitans: AWJ20_935 Help Entry AWJ20_935         CDS       T05270                                  Symbol DID2 Name (RefSeq) Did2p   KO K12197   charged multivesicular body protein 1 Organism slb  Sugiyamaella lignohabitans Pathway slb03272   Virion - Hepatitis viruses slb04144   Endocytosis Brite KEGG Orthology (KO) [BR:slb00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     AWJ20_935 (DID2)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     AWJ20_935 (DID2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:slb04131]     AWJ20_935 (DID2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:slb04147]     AWJ20_935 (DID2) Membrane trafficking [BR:slb04131]  Endosome - Lysosome transport   Endosomal sorting complexes required for transport (ESCRT)    ESCRT-III complex     AWJ20_935 (DID2) Exosome [BR:slb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    AWJ20_935 (DID2)   Exosomal proteins of other body fluids (saliva and urine)    AWJ20_935 (DID2)   Exosomal proteins of colorectal cancer cells    AWJ20_935 (DID2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RAC_head Snf7 BORCS7 GCH_III Motif Other DBs NCBI-GeneID:  30038022 NCBI-ProteinID:  XP_018735148 UniProt:  A0A167DAA2 LinkDB All DBs Position A:complement(2980207..2980551) Genome browser AA seq 114 aa AA seqDB search MRQVTGSMATVVHGMDKAMESMNTEKISLVMDKFESQFEDLDATAQYYENVASSANAVST PQEDVDLLMQKIADEAGLELRQDLDSKETPQTTRVDAIEQVEDSLNERLKALRS NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgagacaggtgacaggcagcatggctaccgtagttcacggcatggataaggccatggag agcatgaatacagaaaagatttccttagtaatggacaagtttgagagccaatttgaagat ctcgatgccacagctcagtactatgagaatgtagcgtctagtgccaatgcagtttccacg ccacaggaagatgttgacctccttatgcagaagattgctgacgaagctggacttgagctt cgccaagatctcgattccaaggagacaccccagaccactcgggttgatgccattgaacaa gttgaagacagcttgaatgaacgacttaaagcattacgttcttaa

DBGET integrated database retrieval system