Streptomyces lydicus 103: SL103_31040 Help Entry SL103_31040       CDS       T04699                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism slc  Streptomyces lydicus 103 Pathway slc00074   Mycolic acid biosynthesis slc00280   Valine, leucine and isoleucine degradation slc00630   Glyoxylate and dicarboxylate metabolism slc00640   Propanoate metabolism slc01100   Metabolic pathways slc01110   Biosynthesis of secondary metabolites slc01120   Microbial metabolism in diverse environments slc01200   Carbon metabolism Module slc_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:slc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     SL103_31040    00640 Propanoate metabolism     SL103_31040   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     SL103_31040   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     SL103_31040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  AOP50098 UniProt:  A0A1D7VUE3 LinkDB All DBs Position 7162262..7162477 Genome browser AA seq 71 aa AA seqDB search MIKVVRGNPTPEELAAALAVVQARAAAAAAGPAPGSGDSGTEWSDPATTVPARSRMPHPG PRAWRTSHWPR NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgatcaaggtcgtacggggcaacccgaccccggaggagctggccgccgcactggcggtg gtgcaggcccgggccgcggcggccgccgccggcccggcacccggcagcggtgactccggc accgagtggtcggatccggcaacgacggtcccggcccggtcccgcatgccgcacccgggg ccgcgggcctggcggacgagccactggccgcgctga

DBGET integrated database retrieval system