KEGG   Streptomyces leeuwenhoekii: sle_13180
Entry
sle_13180         CDS       T04414                                 

Symbol
sle_13180
Name
(GenBank) Alpha-ketoglutarate-dependent taurine dioxygenase
  KO
K18057  pentalenolactone F synthase [EC:1.14.11.36]
Organism
sle  Streptomyces leeuwenhoekii
Pathway
sle00999  Biosynthesis of various secondary metabolites - part 1
sle01100  Metabolic pathways
sle01110  Biosynthesis of secondary metabolites
Module
sle_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:sle00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various secondary metabolites - part 1
    sle_13180 (sle_13180)
Enzymes [BR:sle01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.36  pentalenolactone F synthase
     sle_13180 (sle_13180)
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: CQR60780
UniProt: A0A0F7VMV8
LinkDB
Position
chromosome:complement(1636260..1637159)
AA seq 299 aa
MDVTPIPGAALGAVVRGAQVTGDMDKTQVEQIWAALDAHLVLVFRGHETPSYEEFLAFGR
RFGYIPKTGLTSGAHPDHNEILIVSNLVEDGRKIGVGDAEWMGWHTDYSFRPCVSQVGFL
EAVEVPSSGGGETLFTDMYALYESLSNEERRRLHTYRVRHALRTGYEDTIEEELQGEVSL
GESTERIQPEDGTSTIHPLIARNPRTGRQSVYVSTLNTKRIVDLAPDDSRKLLDELLSHA
GKPQYTYTHTWQPGDIVMWDQLGTVHAKQPFDPAERRIMRQVVSIFDDPTDPWHAEVAA
NT seq 900 nt   +upstreamnt  +downstreamnt
atggacgtaacgccgatacccggcgccgctctcggcgccgtcgtgcgcggcgcccaagtc
accggcgacatggacaagacccaggtggagcagatctgggcggcgctcgacgcgcatctc
gtgctcgtcttccgcggccacgagaccccctcctacgaggagttcctggccttcggccgc
cgcttcgggtacatcccgaaaaccggactgaccagcggcgcccatcccgaccacaacgag
atcctgatcgtctccaacctggtggaggacggccgcaagatcggcgtcggcgacgccgag
tggatgggctggcacaccgactactccttccgcccctgcgtctcccaggtcggcttcctg
gaggccgtggaagtgccgtcctccggtggcggggagaccctcttcaccgacatgtacgcc
ctgtacgagtcgctgtcgaacgaagagcgccggcgcctgcacacctaccgggtccgccac
gccctgcgcaccgggtacgaggacaccatcgaggaggagctccagggcgaggtgtccctc
ggcgagagcaccgaacggatccagcccgaggacggcacctccaccatccacccgctgatc
gcccgcaatccgcgcaccggccgccagtcggtctacgtcagcaccctgaacaccaagcgg
atcgtggacctcgcccccgacgacagccgcaagctgctcgacgaactgctgtcgcacgcg
ggcaaaccccagtacacctacacccacacctggcagcccggggacatcgtcatgtgggac
cagctcggcaccgtccacgccaagcagcccttcgatccggccgaacggcgcatcatgcgc
caggtcgtcagcatcttcgacgatccgaccgacccctggcacgcggaggtcgccgcatga

DBGET integrated database retrieval system