KEGG   Streptomyces liliifuscus: JEQ17_02480
Entry
JEQ17_02480       CDS       T08169                                 
Name
(GenBank) acyl-CoA dehydrogenase family protein
  KO
K21782  L-prolyl-PCP dehydrogenase [EC:1.3.8.14]
Organism
slf  Streptomyces liliifuscus
Pathway
slf00333  Prodigiosin biosynthesis
slf01100  Metabolic pathways
slf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_02480
Enzymes [BR:slf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.14  L-prolyl-[peptidyl-carrier protein] dehydrogenase
     JEQ17_02480
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2 HpaB_N
Other DBs
NCBI-ProteinID: QQM38451
UniProt: A0A7T7KTZ8
LinkDB
Position
568575..569753
AA seq 392 aa
MNFAFDPDVEEMRTMIVAFARRELGGRPEQSDTGFDPDEFRRRWMLAGKQGVVGGVMPLE
YGGSGLDAVAASAVMEALGYGCSDTGFAFSVAAHLFACLMPIVEFGTEEQKRRLLPALCS
GERVAAHAITEPEAGSDALNLRTRAEFRGDHYVLHGSKCFTTNAPVADVFVVQAATEPGG
GFFGLTAFVVEADTPGLSVGPPHNKVGLRGSPTADVHFDGCVVPAADVLGVEGTGAGVFS
SSMKWERTCLFAAYLGAMQRVLESTIDYAGEREQFGAPIGSFQAVSHRLVDMTLRLESAR
LVLYKAAWGLARGDEDDVAPALAKLAVSEAAVQVGLDAIQLRGALGIVEGEAETLLRDAL
PSRVFSGTNEIQKNNIARALGLSGNRRRAGRR
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgaacttcgcattcgacccggacgtcgaagagatgcgcaccatgatcgtggcgttcgcc
cggcgcgagctgggcgggcggcccgagcagtccgacaccggcttcgaccccgacgagttc
cgcaggcgctggatgcttgcgggcaaacagggtgtggtgggtggcgtgatgccgctcgaa
tacgggggcagtggcctggacgcggtcgccgcgtcggcggtaatggaggccctcggatac
ggctgctccgacaccggcttcgccttctccgtcgccgcgcatctgttcgcctgcctgatg
ccgatcgtcgagttcggcacggaggagcagaagcggcgcctgctgccggcgctctgttcg
ggagagcgcgtcgcggcacatgcgatcaccgaacccgaggcgggttccgatgcgctgaac
ctgcgtactcgtgccgagttccggggtgaccactacgtcctccacggcagcaagtgcttc
accacgaacgcgccggtggccgatgtcttcgtcgtgcaggcggcgaccgagccgggtggt
ggcttcttcggcctgaccgctttcgtcgtcgaggccgacaccccggggctcagcgtgggg
ccgcctcacaacaaggtcggtctcagaggctccccgacggccgacgtccacttcgacgga
tgtgtcgtgcccgcggccgatgttctcggagtcgagggcacgggggccggcgtgttctcc
tcgtccatgaagtgggagcgcacctgtctcttcgcggcctacctcggtgccatgcagcgc
gtcctggagtccacgatcgactacgccggagaacgcgaacagttcggcgcacccatcggc
agtttccaagcggtcagccaccgcctggtcgacatgacgctgcgcctggaatccgcccgg
ctcgtgctgtacaaggccgcatgggggctggcgcggggtgacgaggacgacgtggcaccc
gcgctggcgaaactggccgtcagtgaggcagccgtccaggtgggcctcgacgcgatacag
ctgcgtggcgcactcggcatcgtcgagggagaggccgagaccctgttgcgcgacgcgctt
ccctctcgggtcttctccgggacgaacgagatccagaagaacaacatcgcccgggcgctg
ggcctgagtgggaaccgccgccgggccgggcgtcgctga

DBGET integrated database retrieval system