KEGG   Streptomyces liliifuscus: JEQ17_02495
Entry
JEQ17_02495       CDS       T08169                                 
Name
(GenBank) RedV protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
slf  Streptomyces liliifuscus
Pathway
slf00333  Prodigiosin biosynthesis
slf01100  Metabolic pathways
slf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_02495
SSDB
Motif
Pfam: Nitroreductase
Other DBs
NCBI-ProteinID: QQM46446
UniProt: A0A7T7L4Q6
LinkDB
Position
complement(571265..572425)
AA seq 386 aa
MRQAADVAALSPSSHNCQPWGVAWPTSPGARQEAALLVGEAPDGSSTDEPETDEYVILAL
DRQRRLTSLPAHAVEMLISCGAYLQILLHSLALEGWSTDLIRFVDPLSDERTSGTPSAGR
PLGDTWPPLWSPLCAVRLRRTDESSGRLAELRETALARRTNRGPYRPEALDPTVLAGLCA
PWAGAAEGADVTVRHLVTDGERSTFAHFVARHGGRDFSHRQAWRETHSFLRRNEAEAVAR
GDGFTLGQLFGPMSGPRRHILRAALAPTTMRVLRHAGYPRLLARQLALVVRPTPAIVTMS
FAETAPGLEDAVRGGAHLAEYWMRATDAGLALHPVSVVLQHDDVRTELQDRLGLPGRTFF
VSRLGRPLTQFPRSPRRTGARAVRMI
NT seq 1161 nt   +upstreamnt  +downstreamnt
ctgcgccaagcagccgatgtcgccgcgctcagcccgtcgtcccacaactgccagccctgg
ggcgtcgcatggcccaccagccctggtgcccgtcaggaagcggccctgctcgtcggcgag
gcccccgacggcagcagcaccgatgagcccgaaacggatgagtacgtaatcctggccctc
gaccggcagcgccgcctcacttcccttccggcgcacgccgtcgagatgctgatcagttgc
ggcgcgtatcttcagatcctgttgcactcactggctcttgagggctggtcgacggacctc
atccgcttcgtcgacccactctccgacgagcgcacgagcggaaccccgagcgcgggccga
ccactcggtgacacctggcccccgctgtggtcacctctgtgtgccgtccggctgcgccgc
acggacgagtcctccggtcggctcgccgaactccgggagaccgcactggctcgacggacc
aaccgggggccctatcgccccgaagcgctcgaccccactgttctggccggcctctgcgcc
ccgtgggcaggcgccgccgagggcgcggacgtcactgtccggcacctcgtcaccgacggc
gagcgctcgactttcgcgcacttcgtggcccgccacggtggacgtgacttcagccatcgg
caggcctggcgtgaaactcattcctttctgcgccggaacgaggccgaggccgtggcacgc
ggtgacggcttcaccctcggtcagctgttcggaccgatgtcggggccgcgtcggcacatc
ctgcgcgccgcactcgctcccacgacgatgcgggtgctacggcatgcgggatatccccgc
ctgctcgcccgccaactcgccctcgtcgtacggccgacgcccgccatcgtcaccatgagt
ttcgccgaaacggctcccggcctcgaagacgctgtccgcggtggagcgcacctggccgag
tactggatgcgcgccacggacgcggggctcgccctgcacccggtcagcgtcgtcctgcag
cacgacgatgtacgaacggagctgcaggaccggctcggactgcccggacgcaccttcttc
gtgagccggctcgggcgtcccctcacgcaattcccccggtcaccgcggcggaccggcgcc
cgggcggtgcggatgatctga

DBGET integrated database retrieval system