KEGG   Streptomyces liliifuscus: JEQ17_02540
Entry
JEQ17_02540       CDS       T08169                                 
Name
(GenBank) aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
  KO
K21784  4-hydroxy-2,2'-bipyrrole-5-methanol synthase
Organism
slf  Streptomyces liliifuscus
Pathway
slf00333  Prodigiosin biosynthesis
slf01100  Metabolic pathways
slf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_02540
SSDB
Motif
Pfam: Aminotran_1_2 PP-binding Cys_Met_Meta_PP Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_5 DUF6100 LppA
Other DBs
NCBI-ProteinID: QQM38459
UniProt: A0A7T7HZX7
LinkDB
Position
578193..580094
AA seq 633 aa
MTHIMGNRQENTGIHRQVLDIIASRTLYDESYLLPDSHFEAELGIDSVIFESILASVREQ
FSLATQLPPGIATIGELVRAVEEALGRGGDAPSPTEPGVATASEGDDPLLDAVVTMTMRH
TQYQRDQLALDADFESELGIDSVLLAAIVADSARELGLPSTLAGTVTAASVRDLVTALRP
FHDGMQPGDQGFGGDRPPGVGAVADESAAQWDSAWDGRSMKDFVEERDGDLFAKARSFGT
YLRRREADRLYWYGMPLHSRCSNRAVIFDETEGRTREFLMFASNNYLGLANHPKVIEAVC
DATRQYGATHTGSRFIGGTNTLHKELERRLAAFKQRPACIVYPGGYSANVGAISALVKSY
DTLVVDKLNHMSIVDGARLSGGTRKIYQHNDMADLERILKRSDDTSGGKLIVADGVFSMH
GDICDLPEIVRLAKEYGARIMIDDAHSTGVLGRRGSGTAEHFGLKGEVDLELGTMSKALA
GMGGFVVGEEEVVEYLRYYSNSYVFAANIPAGVAAGLIASIDVIEAEPERIAELWSNIRL
LHSQLSDAGFDLENTRSAILPIVIGDERKAMEMGRAVRARGLFCQTVVFPGVPLGDARLR
VSVTSEHTRDDLETAAGIFVEAGREVGVLPSAG
NT seq 1902 nt   +upstreamnt  +downstreamnt
atgacgcacatcatggggaaccggcaggagaacaccggcatccatcggcaggttctcgac
atcatcgcctcgcggacgctgtacgacgagtcctatctcctgcccgacagccacttcgag
gcggagctcggcatcgactcggtcatcttcgagtcgatcctggcctcggtgagggagcag
ttctccctggcgacgcagctgccgcccggcatcgccacgatcggcgagctcgtccgtgcg
gtcgaggaggcactcggccggggcggcgacgcaccctcgccgacggagccgggcgtcgcc
acggcttccgaaggggacgatccgctcctcgacgcagtcgtcaccatgaccatgcggcac
acccagtaccaacgcgatcaactggcgcttgacgccgacttcgagagcgagctcggcatc
gactccgtgctcctggccgcgatcgtggcggactcggcccgggagctcggccttcccagc
actctggcaggcaccgtcaccgcggcgtccgtgcgcgatctcgtcacggcactgcgtccg
ttccacgacggcatgcagcctggggaccagggctttggcggcgaccggccacccggggtc
ggcgcggtcgcggacgagtcagccgcgcagtgggactcggcctgggacggccgctcgatg
aaggacttcgtggaggagcgcgacggcgacctgttcgccaaggcccgcagcttcggcacg
tacctgcgacggcgggaggccgaccggctctactggtacggcatgcccctgcattcccgc
tgctcgaaccgggccgtcatcttcgacgaaacagagggccgcacacgcgagttcctcatg
ttcgcgtccaacaactacctcggcctcgccaaccaccccaaggtgatcgaggccgtctgc
gacgccacgcgccagtacggagccacgcacaccggctcccggttcatcggcgggaccaac
acgctccacaaggaactggagcggcgtctggcggccttcaagcagcggccggcctgcatc
gtctaccccggtggatactccgcgaacgtcggtgcgatctccgccctggtcaagagctac
gacaccctggtggtcgacaagctcaaccacatgagcatcgtggacggcgcccggctctcc
ggtggcacccgcaagatctaccagcacaacgacatggccgacctggagcgcatcctgaag
cgctccgacgacacgtcgggcggcaaactgatcgtcgccgacggcgtgttcagcatgcac
ggcgacatctgcgaccttcccgagatcgtccgcctggcgaaggagtacggcgcccggatc
atgatcgacgacgcccactccacgggcgtgctcggccggcggggttccggcaccgccgag
cacttcgggctcaagggcgaggtcgacctcgaactcggaacgatgagcaaagccctcgcg
ggcatgggcggcttcgtcgtcggcgaggaggaggtcgtcgagtacctccgctactactcg
aactcgtacgtgttcgccgcgaacatccccgcgggcgttgcggccgggctgatcgcgtcg
atcgacgtcatcgaggcggaacccgagcggatcgcggaactgtggtccaacatccggctc
ctccacagccagttgtcggacgccggtttcgacctggagaacactcgcagcgccatcctc
cccatcgtcatcggcgacgagcgcaaggcgatggagatggggcgcgcggtacgcgcgagg
gggctcttctgccagacggtcgtcttcccgggcgtgccgctcggcgacgcgcgactgcgt
gtcagcgtcacctcggaacacacaagggacgatctggagaccgccgcgggcatcttcgtc
gaggccggccgtgaggtcggtgtcctgccgtcggcggggtga

DBGET integrated database retrieval system