KEGG   Streptomyces liliifuscus: JEQ17_02550
Entry
JEQ17_02550       CDS       T08169                                 
Name
(GenBank) aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
  KO
K21792  polyketide synthase
Organism
slf  Streptomyces liliifuscus
Pathway
slf00333  Prodigiosin biosynthesis
slf01100  Metabolic pathways
slf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_02550
SSDB
Motif
Pfam: ketoacyl-synt AMP-binding Acyl_transf_1 Aminotran_1_2 Ketoacyl-synt_C Epimerase 3Beta_HSD GDP_Man_Dehyd PP-binding NAD_binding_4 NAD_binding_10 KAsynt_C_assoc RmlD_sub_bind NmrA Thiolase_N Polysacc_synt_2 Cys_Met_Meta_PP Glyco_transf_4 adh_short
Other DBs
NCBI-ProteinID: QQM38461
UniProt: A0A7T7HZW3
LinkDB
Position
581766..589547
AA seq 2593 aa
MNQDPNETHLRGNGPKTVAALLRHHLEHRPGALAYRFLSGTRQGRSGGDGESWDYRELDL
RVRAVASLLQREGLSGKPVLLLHPPGLDYIAGFLGCLYAGAIAVPAYPPETRRFGQTMPR
LAAIARDSRATHALTTGALSRFAATKRREIDSLGLAGLRWLATADLGTAGADDWRDPDVD
SDSTAFLQYTSGSTSSPKGVMVSNGNLLHNLRSIHRRLEHDTESGMVSWLPPYHDMGLIG
GILTPLYGGFPAHLMSPASFVRQPLLWLETLSRTRASTSVAPNFGFEHCVRRITDEQLSG
LDLSHWRLALNGAEPVRADTLDRFAERFAPCGFVRRALLPCYGLAEATLMVTGVGAHEPP
TVGTFVPAALGVGVARPAGGPESGRAIRTVGCGPAVDGVDVAIVDADTRRRITDEERVGE
IWVAGGSVAHGYWRRPEATEETFRARVEGEGETSYLRTGDLGFLSGGQLHVVGRIKDVVI
VQGRNHYPQDIELTVEQADEAIRPGSGAAFSIEVDGAEELVVAYEIEGRRVDGASALLAK
LRTAIAEQHEVAPHAVVLLKRSTVHKTTSGKIQRQACKRAFLDLGLSVVAASVTRDVEVS
PSVDRPAGLSVAQRGQRVTDAVTEALTGVPAAADAPDLTGWTFAELDLDYPALLTAVRGL
EEKLGTRIAVGELLALPRVDSLIDLFLGEAPQGGTAGSSREDAARPSELRKPEAVEAWLV
GEVARCLGVPVTSVDVTRPLTSLGLDSKQAAAILAELGARTGREVTTGTAFEHPTIQAVV
AHIGTSQTSADTPLAELPPRHQEPRSEPIAVIGMGCRFPGAPDTDSYWRLLVDGRDAITE
IPGDRWAPGQVNAPAFGGFIDRVDEFDARFFGLSAREAVRMDPQQRLLLETAWQTVEDAG
LDPTGLSGSATGVFVGISSHDYSELQMSRPETIDVHAATGNAHSIAANRLSYTLDLRGPS
LALDAACSSSLLAVHLACESLRRGECDSALAGGVNLLITPGLSVAFAQGNMLSPDGRCRT
FDDSANGYVRGEGVGLVLLKPLSAALADGDPVHAVIRGSATAHGGRSNGLTAPRGSAQRS
VIERALAQAGLSGRAVDYVEAHGTGTSLGDPVEWEGLAAAYGKGRSTGDRCLVGSVKTNI
GHLEAAAGIAGLIKAALVVRHRQVPPTLHLRTPNRRLVWEDAGLDVPTRLVDLPDAGVVR
AGVSSFGFGGSTAHLVLESAPEPDPIDAVAPKRPVHALCLSAHTGTALTTLAQRWRTHLA
GHPDAELADLCHTAHTGRAQLPFRAVVTGGSRAAFDTALDTLARGGPSTVVVRGHARPGY
APKVAFLFSGQGTQYTGMGKGLYDTHTGFARTLDRADRVLRPHLGLPLTELLFGEGGTEK
LANTRYCQAALVALEVALAELWISLGVRPAALLGHSIGAYGAACVAGMMSLEDALALAVV
RGRSMAEQPGDGAMIACAGDAEVIRAAVADSDSVAVAAVNAPEQLVLSGPRTEIDRVRAR
LEGQSVVVRPLAVSHAFHSPLMAGAAQPLRAAALDVEFREPEYPWVFDATGEQVTGRIGA
DDWARHMLGPVRFADGFATLRRLGCDAFVEIGPHPTLLNTARTMTASEDEESVLWLPSLR
RVRGGPVGDGDWQTLLQSLGRLHCAGGRVDWAALDEGSRRPRVPVPHAVLEGQRYWFSPP
SETDTTVDRPDREVGPTSTAPVPMPAAEVGNDPAEPGPVRSAAVVADAVRDSVRSEVVRQ
VARTCAFPPEQIPIGARLGADLGFDSLMRTELERSLARQFPEHLEKYRESVPEDPTVGEL
VALLGADGQQAPRSDDLPAAPRSPRPVASAVPVRSRDGSGPPVKQERAFEEWAEYAELQG
RLRQVRASGSNPYGRVHEGYNSGRASVDGRQVINFSSFNYLALSNHPRVRRAAQEAIERY
GTSSSATPLLFGETPLHRELDAEIASFLGTEAAIVFAGGHATNVATIGHLFGPEDLVLHD
EWIHDSALRGCMLSGARRRPFPHNDWRALDAMLGTLRPGARRVLVLIEGAYSQDGDVPDL
RRFIDVKARHGAMLMIDEAHSIGVLGRTGRGIGEYFGVDRRDVDLWMGTLSKAIGSLGGY
VAAREPIIEYLRFTAPLHIFSTGISPANTAAALEAIRVIRDEPQRVARVRQLSERFRDSA
RARGLDIGVSRASAVIPVVIGDWERTMALSNTLLDQGVNVMPIGYPAVARDECRLRFFLN
ADHVEEDLEHTLDLLGRAMSENTHTTPSPEPEPLRDAAAADVLVTGASGFIGGHLTRRLA
ERGHRVRVLVREGSDRSAFAGVDVEVVIGGLGDPASLRRATAGVRHVYNCAGMSADWGPW
EEFRRINVDGSRNLVEAAHHAGTVERLVHLSTTDVYGYPVAPCDESAEPKDIGLPYNRSK
VLGERAVRQAAERTGLPVTVIRPVSVYGPRSKDFVIEIATLLLGRQMVYIRGGAVPAGLV
YVGNLVDGMIAACTSDAAVGKAYNLRDPDATTWREYVEALALGLGVKPPAFSLPTPLARG
VATVSEKLYGALRVKSRPVLTRHAVHLFDRDQSYAIDRARDDFGFKSEVGFEAGIELTLA
WLDSPEGRKAVAR
NT seq 7782 nt   +upstreamnt  +downstreamnt
atgaaccaggatcccaacgagacacacctgcgggggaacgggccgaaaaccgtcgccgcg
ctgctgcggcaccatctcgaacatcgtccgggcgcgctcgcctaccgtttcctctcggga
accaggcaaggccgctccggcggcgacggcgagtcatgggactaccgcgaactcgacctt
cgcgtccgggccgtggcctcgcttctccagcgtgagggcctgtccggcaagccggtcctg
ctgctccatcccccggggctcgactacatcgccgggttcctcggctgcctctacgccgga
gcgatcgccgtaccggcctatcccccggagacacggcgcttcggccagaccatgccgcgt
ctcgcggcgatcgcccgggactcgcgggccacacacgcactcacgaccggggcgttgtcg
cggttcgcggccacgaaacggcgtgagatcgactcgctcgggctcgccggtctgcgctgg
ctggcgaccgccgacctcggcaccgccggagccgacgactggcgagaccccgatgtcgac
agcgactcgacggccttcctccagtacacctccggttcgacctcgtcccccaagggcgtc
atggtcagcaacggcaacctgctgcacaatcttcgttcgatccatcgcaggctggagcac
gacaccgagtcgggaatggtgtcctggctgcccccgtaccacgacatgggtctcatcggc
ggcatcctcacgcccctgtacggggggtttcccgcgcatctcatgtccccggcgtccttc
gtacggcagccgctgctgtggctggagacgctttcgcggacccgggcgtccacgagcgtg
gcccccaacttcgggttcgagcactgcgtacgccggatcaccgacgagcagctcagcggc
ctggacctgagccactggaggctggcgttgaacggcgccgagccggtacgcgcggacacc
ctcgaccggttcgccgaacggttcgcgccctgcggcttcgtacgccgcgccctgctgccc
tgctacggcctcgcggaggccactttgatggtgacgggagtcggcgcgcacgagccgccg
acggtcggcacgttcgtgcccgcggcactgggcgtgggagtcgcccggcccgcgggcgga
ccggagagcgggcgggcgatccgcaccgtcgggtgcggccccgccgtcgacggggtggac
gtcgccatagtcgacgccgatacgcgacggcggatcaccgacgaagagcgcgtcggagag
atctgggtcgcgggcgggagcgtggcacacgggtactggcgccgccccgaggccacggag
gagaccttccgggcccgcgtcgagggcgagggagagacgagttacctgcgcaccggcgac
ctcggcttcctcagtggcggccagctgcatgtcgtcggacgtatcaaggacgtcgtcatc
gtgcagggccgaaaccactacccgcaggacatcgaactcaccgtcgagcaggccgacgag
gcgattcggccgggctcgggcgcggccttctcgatcgaggtcgacggcgcggaggaactc
gtcgtcgcctacgagatcgagggcaggcgcgtcgacggcgcgtcggcgcttctggcgaaa
ctgcgcacggccatcgccgagcagcacgaggtcgcgccgcacgccgtcgttctcctcaag
aggtcgacggtccacaagaccaccagcggcaagattcaacggcaggcgtgcaagcgggcc
ttcctcgacctcgggctctcggtggtggcggccagtgtcacgcgggacgtcgaggtgtct
ccgtccgtggaccgtcccgccggtctgtccgtcgcccagcgcgggcaacgggtgaccgac
gcggtcacggaggcgctgacgggagtcccggcggccgccgacgccccggatctgaccggc
tggacgttcgccgaactcgacctggactacccggcgttgctgaccgccgtgcgcgggctg
gaggaaaagctcggcacgaggatcgccgtgggcgagctgctggcgcttccgcgggtcgac
agcctgatcgacctgtttctgggtgaggcaccgcagggcgggacggccggctcctcgcgg
gaggacgccgctcggccctccgaactgcgtaagccggaggcagtggaggcatggctggtc
ggagaggtggcccggtgcctgggagtgccggtcacctcggtcgacgtcaccaggcccttg
acctcgttgggcctcgactcgaagcaggccgccgcgatcctcgcggagcttggagccagg
acggggcgcgaggtgaccacgggtaccgccttcgagcacccgaccatccaggcagtcgtg
gcccacatcggtacttctcagacgtcggccgacacgcccctcgcggagctgccgccccgg
caccaggaaccccggtccgagccgatcgcagtcatcggtatggggtgccgctttcccgga
gcacccgacacggacagctactggcgtctcctggtcgacggacgcgacgcgatcaccgag
atacccggcgatcgctgggcaccggggcaggtgaacgctcccgccttcggcggcttcatc
gatcgcgtggacgagttcgacgcccgtttcttcggcctgtcggccagggaagcggttcgg
atggatcctcagcagcggttgctcctcgaaaccgcctggcagacggtggaggacgcgggt
ctggacccgacggggctctcgggcagcgcgaccggcgtgttcgtcggcatcagcagccac
gactactccgagctgcagatgagccgaccggagacgatcgacgtccacgcggcgaccggc
aacgcgcactccatagcggcgaacaggctgtcgtacacactcgatctgcgagggccgagt
ctcgctctggacgccgcgtgctcgtcctcgctgctggcggttcacctcgcgtgcgagagc
ctgcggcgcggcgagtgcgactcggccctggccggcggagtgaacctgctcatcacaccg
gggctttcggtggcgttcgcccagggcaacatgctctccccggacggacggtgccgtacg
ttcgacgactccgcgaacggctacgtgcgcggtgagggtgtgggcctggtcctcctcaag
ccgctctccgcggccctcgccgacggcgatccggtccatgccgtgatccgggggtcggcc
accgcacacggcggccggagcaacggccttacggcaccgaggggttcggcccagcggtcc
gtcatcgaacgggccctggcccaggcgggtttgagcggccgggccgtcgactacgtcgag
gctcacggcaccggcacctcgctcggcgaccccgtcgagtgggagggcctcgcggccgcg
tacggaaaggggcggtccacaggcgaccgctgcctcgtggggtcggtcaagaccaacatc
gggcacctggaggcggccgcgggtatcgccggactcatcaaggcggccctcgtcgtacgg
caccgccaggtaccgccgacgctccacctgcgtacgccgaaccgccgcctggtctgggag
gacgccgggctcgacgttccgacacggctcgtcgatctgccggacgcgggcgtcgtacgg
gccggagtcagttcgttcggattcggcgggtcgaccgcacatctggtgctcgaatcggcc
cccgagccggacccgatcgacgcggtggccccgaagcggcccgtacatgccctgtgcctg
tcggcgcacacggggaccgccctcaccacactggcacagcggtggcgcacacacctggcc
ggccatcccgacgcggagctcgcggatctctgccacacagcccacacgggccgggcccag
ctccccttccgggcggtcgtcaccggcggctcccgggcggcgttcgacaccgcgctcgac
acgctggcccgcggcggaccgtcgaccgtcgtggttcgcggtcacgcccggcccgggtac
gccccgaaggtcgcgttcctcttcagcggccagggcacgcagtacacaggcatgggcaag
ggcctgtacgacacgcacaccgggttcgcccgcaccctggaccgcgccgaccgtgtcctg
cgtccgcacctcggcctcccactgaccgaactgctcttcggggagggcggtaccgagaag
ctggcgaacacccgttactgccaggccgccctggtggcactggaggtcgcactcgccgag
ttgtggatctcgctcggtgtgcggcccgcggctcttctcgggcacagtatcggggcgtac
ggcgccgcgtgcgtggccgggatgatgtccctggaggacgctctggcgctggccgtggtg
cggggcaggtccatggccgaacagcctggcgacggggcgatgatcgcctgtgccggagac
gcggaggtgatccgcgcggcagtcgccgacagcgactcggtcgctgtcgccgccgtcaac
gcccccgagcagctggtgctgtcagggccccgcaccgagatcgacagggtccgtgcccgg
ctcgaaggccagtctgtcgtcgtcaggccactggcggtgtcgcacgccttccactccccg
ctgatggccggtgcggctcaaccgctgcgcgcggcagccctcgatgtcgagttccgggag
ccggagtacccctgggtcttcgacgccaccggcgagcaggtcaccgggcggatcggggcc
gacgactgggcccggcacatgctgggcccggtgcgcttcgccgacggtttcgccacgctc
cgtcgccttggctgcgacgccttcgtggagatcggcccgcatccgaccctgctcaacacg
gcgcgcacgatgacagcctcggaggacgaggagtcggtgctgtggctgccctctctgcga
cgggtccgcggcggcccggtgggcgacggtgactggcagacacttctgcagtcgctgggc
cgcctgcactgcgcgggcggacgcgtggactgggccgccctcgacgagggatcccgcagg
ccgcgagtcccggtaccgcacgcggtcctcgaaggacagcggtactggttctcgcctccg
tcggagacggacaccaccgtcgaccggccggatcgtgaagtcgggccgacgtccacagcg
cccgtgccgatgccggccgccgaggtcgggaacgaccctgcggagcccggaccggtgcgg
tccgccgcagtcgtcgcggacgcggtgcgggactcggtgcgaagcgaggtggtgcgtcag
gtcgcacggacgtgtgccttcccgcccgaacagatcccgatcggcgcccggctcggtgcg
gacctcggattcgactcgctgatgcggaccgaactggagcgctccctggcccggcagttc
cccgagcacctcgagaaataccgggagtcggtacccgaggacccgaccgtcggtgaactg
gtggctctgctgggcgccgacggacagcaggccccgaggagcgacgatctcccggcggcc
cctcgctcgccccgacccgtggcatcggccgtgcctgtgcgttccagggacggttccggt
ccaccggtgaagcaggagcgcgcgttcgaggagtgggccgaatacgccgaactccagggc
cggctccgacaggtgagggcgagcggctcgaatccgtacggccgagtccacgagggctac
aactccggtcgtgcctccgtcgacggtcgccaggtcatcaacttctcctcgttcaactac
ctcgcgctgtcgaatcacccgcgcgtccgccgagctgcgcaggaggccatcgagcggtac
ggcacctccagttccgcgacgcccctgctgttcggtgagacgccgctgcaccgcgaactg
gacgccgagatcgcctcgttcctcggcaccgaggccgccatcgtcttcgccggtggccac
gccacgaacgtggcgaccatcggacatctcttcgggcccgaggacctcgtcctgcacgac
gagtggatccacgacagcgcgctgcgcggctgcatgctgtcgggtgcgcggcgccgtccc
ttcccgcacaacgactggcgggcgctggacgcgatgctgggcaccctgcgcccgggggcc
cgacgggtcctggtactcatcgagggcgcgtacagccaggacggcgacgtccccgacctg
cgcaggttcatcgacgtcaaagcgcgccacggcgcgatgctgatgatcgacgaggcgcac
tcgatcggcgtcctcgggagaacgggccggggcatcggcgagtacttcggcgtcgaccgc
cgtgatgtcgatctgtggatgggcaccctgagcaaggcgatcggcagcctcggcggctat
gtcgcggctcgcgaaccgatcatcgaatacctcaggttcaccgcaccgctgcacatcttc
agcaccgggatctcgccggcgaacacggccgcggctctggaggcgatccgggtcatcagg
gacgagccgcagcgcgtggcccgggtgcgacaactgtccgagcgcttccgcgactcggca
cgggcccgcggactcgacataggtgtgtcacgggcctcagccgtgatcccggtcgtcatc
ggcgactgggagaggacgatggcgctctccaacaccctgctcgaccagggcgtgaacgtg
atgccgatcggctacccggccgtcgcccgcgacgagtgccgtctgcgcttcttcctcaac
gcggaccacgtcgaagaagacctggaacacaccctcgacctcctgggacgagccatgtcg
gagaacacgcacacgaccccctcgcccgagccggagccgcttcgcgacgccgctgccgcc
gacgtcctggtcaccggggcgagcggcttcatcggcggacatctgacccgtcggctggcc
gagcgcggccaccgcgtacgggtgctggtccgggaaggcagcgaccgttccgccttcgcg
ggtgtcgacgtcgaggtggtgatcggtggactcggcgatccggcaagtctgcgtcgtgcc
acggccggtgtgcggcacgtctacaactgcgcgggcatgtcggccgactggggcccctgg
gaggagttccggcggatcaacgtcgacggcagccgcaacctcgtcgaggcggcccaccac
gcgggtaccgtcgagcgcctcgtccatctcagcaccaccgacgtctacggctatccggtg
gcaccctgcgacgagagcgcggaacccaaggacatcgggctgccgtacaaccgcagcaag
gtgttgggggaacgcgccgtgcggcaggccgccgagcgcaccggtctgccggtgaccgtc
attcggcccgtgtcggtctacggtccgcgcagcaaggacttcgtgatcgagatcgcgacg
ctgctgctgggccggcagatggtctacatccgcgggggtgccgtaccggccggactcgtc
tacgtgggcaatctcgtcgacggaatgatcgccgcgtgcacgtccgacgccgcggtgggc
aaggcgtacaacctgcgggaccccgatgcgacgacctggcgggagtacgtggaggcgctg
gccctcggtctgggtgtgaagcctcccgcgttcagcctgccgactccgctggcgcgcggc
gtggccacggtctcggagaagctctacggcgccctgcgggtgaagtcccgccccgtactc
acccgtcacgccgttcatctgttcgaccgcgatcagtcctacgccatcgaccgggcccgc
gacgacttcgggttcaagagcgaggtgggcttcgaggcaggcatcgagctcacgctggcc
tggctggactcaccggagggccgcaaggccgtcgcccgctga

DBGET integrated database retrieval system