KEGG   Streptomyces liliifuscus: JEQ17_02560
Entry
JEQ17_02560       CDS       T08169                                 
Name
(GenBank) methyltransferase domain-containing protein
  KO
K21786  4-hydroxy-2,2'-bipyrrole-5-carbaldehyde O-methyltransferase [EC:2.1.1.-]
Organism
slf  Streptomyces liliifuscus
Pathway
slf00333  Prodigiosin biosynthesis
slf01100  Metabolic pathways
slf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_02560
Enzymes [BR:slf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-
     JEQ17_02560
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_12 Methyltransf_31 Methyltransf_23 Methyltransf_11 Methyltransf_2 NodS CheR CMAS Methyltransf_20 Methyltransf_24 Methyltransf_4 Ubie_methyltran MTS TehB UPF0020 PCMT PrmA DUF938 Methyltransf_9 Methyltransf_32 Methyltransf_18
Other DBs
NCBI-ProteinID: QQM38462
UniProt: A0A7T7KTR9
LinkDB
Position
590503..591582
AA seq 359 aa
MDLLSLARTVKDRVEAPITDVLAVAKVVTDPRTPLLLALSTVVVTPLYRAAFLASASGSG
VLRCLAVRPCDLESLAEYLEVPEDRERLRTWLETGVRLGEFEVREGCYRLRSTTAKLLAQ
SGNDAVAAALEEIMRFHLPVLLDAPRMLKEGRRFSLDDQDGTVIARSSLALQGLVHEAID
RTLERTTPIRLLEIGCGSGAYVRHAARLNPRLTALAVDLQEEVAVRAADNMTEWGLTDRV
ETRQGDLRTLELQPQFDLVTLHNNIYYFPEADRVEVLERARSFLAPGGRLLLTSSCQGGG
NLGLDVLNLWFEYADFGGPLPSEDELVAQLEKAGFADVRASRIIPTQPFRAFVGTNVQA
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggatctactgagcctggccaggaccgtcaaggaccgggtggaggcgccgatcacggat
gtgctggccgtggcgaaggtcgtcaccgatccacggaccccgctgctcctggcgctctcc
accgtggtggtcactccgctgtaccgggcggccttcctggcgtccgcctccggttcgggc
gtgctgcggtgtctggcagtgcgcccctgcgacctggagagcctggccgagtacctggaa
gtgcccgaggaccgggagcggctgcgcacctggctggagacgggcgtccgcctcggcgag
ttcgaggtgcgcgaggggtgttaccgcctcaggagcaccacggccaagctcctggcccag
tcggggaacgacgcggtcgccgccgccctcgaagagatcatgcggttccacctgccggtg
ctcctggacgcgccccggatgctcaaggagggccgccgtttctccctcgacgaccaggac
ggcacggtcatcgcccgttcctccctggccctgcagggactggtgcacgaggcgatcgac
cgcactctggagcgcaccacccctatccggctgctggagatcggctgcggatccggtgcc
tacgtccgccacgccgcgcgcctcaacccccgcctgaccgccctcgcggtcgaccttcag
gaagaggtcgctgtccgggccgccgacaacatgaccgaatgggggctcaccgaccgcgtg
gagacccgccagggtgatctgcgcaccctcgaactccagccccagttcgacctcgtcacg
ctccacaacaacatctactacttccctgaggccgaccgggtcgaggtgctggaacgagcg
cgctccttcctggcgcccggcggccggctgctcctcacgtcgtcgtgccagggcggcggc
aacctcggcctcgacgtgctcaacctctggttcgagtacgccgacttcggtggcccactg
cccagcgaggacgagctggtcgcccagctggagaaggcggggttcgcggacgtacgggcg
agccggatcattcccacccagccgttccgcgcgttcgtcggaaccaacgttcaggcctga

DBGET integrated database retrieval system