KEGG   Streptomyces liliifuscus: JEQ17_02565
Entry
JEQ17_02565       CDS       T08169                                 
Name
(GenBank) phosphoenolpyruvate-utilizing enzyme
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
slf  Streptomyces liliifuscus
Pathway
slf00333  Prodigiosin biosynthesis
slf01100  Metabolic pathways
slf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_02565
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: QQM38463
UniProt: A0A7T7KU05
LinkDB
Position
591604..594336
AA seq 910 aa
MDTRTAHTPASALSDTASNAPHRELVAVLGRAPGAGTETLGGKAARLSEMIEAGLPVPPA
FCLTTGLFDLFLRETGLAAEIRAAEARAADTSTIRELITARELPEAIADTILAAYEDLGR
PRVAVRSSACREDSAAQSFAGQHDTVLDVAGDEALLDAVKVCWASLWSDRAAAYRDGTGP
TGSIAVIVQEMIHADVSGVLFTVDPVGARPNRLVVEACCGLGEGLVSGRVSSDFFVVDDR
TLEVIEEHVRYKVTKCAPLTPGRIGMTKVDAADRNAPCLTREQLGELAGLAVEVRSHYGT
EQDIEWAMHDGTLHLLQARPITTHPQDRATDQEHSPYVARQADEVQHGTLWSRMDIGEIF
VGLMSPLGMSFAQYYQEHVHADCAAALGVRDTGDVGLHMGYLQGHVYLNISYTAYLLGQC
LPTRDQRHFTRRFVSEEVDLAAYENPFGTFPGGMEDLRSTLHWVQSTATEMLSMKNRAEE
MVSVRLYEFDRARQLDLTRMSRRELDAELARYLGFFHDAHVGYMPYYINAFGFYGVLTEL
CAKWLGADGDNLQNRIKTDMSSLRTVASAQEIWGVAQAAKARPRVMGIINEAPLEEIEER
LRQDVEGLAFWDTQMKPFLRANGTRGRQEMELTHPRWIDDPSYIFQMIRRYAADGLSVDD
IMGRSRALADGDARTVLEKLPLHRRKVLETVITMYSLCSELRETTRMSMITSIWLVRNVV
YEVGRRLVAEGVLHSLDEVAFLDFEDVRAYLAGGATERESFPRTELDERRRLYEYHNRLP
EPSLTFIGEHDITRAVRPAADGAHLVGLGSSPGRIVGRARIVEDLVWQADEFLPGEILVT
RYTDASWTPLFAIAGGVVTDIGSMLSHSSIVSREFNVPSVVNTKYATQRINTGDMIVVDG
DTGVVEVVEG
NT seq 2733 nt   +upstreamnt  +downstreamnt
atggacacccgaacggcacacacccccgcctccgccctctccgacaccgcgtcgaacgcc
ccgcaccgcgaactcgtggccgtgctcggccgcgcgcccggcgccggtaccgagaccctg
ggcggcaaggccgcccggctgagcgagatgatcgaggcgggcctccccgtaccgcccgcg
ttctgcctcaccaccggcctgttcgacctgttcctgcgcgagacgggcctcgccgcggag
atccgggccgccgaggcccgcgcggcggacacctcgacgatccgcgagctgatcaccgcc
cgggagctgcccgaggccatcgccgatacgatcctcgccgcctacgaggacctcggccgg
cccagggtcgcggtccgttcctccgcgtgccgggaggactccgccgcccagtccttcgcc
ggacagcacgacaccgtcctggacgtcgcgggtgacgaggcgctgctcgacgcggtgaag
gtctgctgggcctctctgtggtccgaccgcgcggccgcctatcgcgacggaacaggcccc
acgggctccatcgccgtgatcgtgcaggagatgatccacgcggacgtcagcggtgtgctg
ttcaccgtcgatcccgtcggcgcacggcccaaccgccttgtcgtggaggcttgttgcggt
ctcggcgaggggctggtctccggacgggtgtccagcgacttcttcgtcgtcgacgaccgc
acactggaggtgatcgaggaacacgtgcggtacaaggtgaccaagtgcgcgcccctcaca
cccggccggatcggcatgaccaaggtcgacgccgccgaccgcaacgcaccgtgcctgacc
cgggaacaactcggcgagctcgccggcctcgcggtcgaggtccggtcccactacggcacg
gagcaggacatcgagtgggccatgcacgacggcacactccacctcctacaggccaggccg
atcaccacccacccccaggacagggctacggaccaggagcacagcccgtatgtcgcccgg
caggccgacgaggtgcagcacggcacgctctggtcccggatggacatcggcgagatcttc
gtgggcctgatgtcaccgctcggcatgagcttcgcgcagtactaccaggagcacgtgcac
gccgactgcgccgccgcgctcggcgtgcgggacaccggtgacgtcggcctccacatgggc
tacctccagggccatgtgtatttgaacatctcctacacggcctacctgctcggtcagtgc
ctgcccacccgggaccagcggcacttcacccgacgcttcgtcagcgaggaggtcgacctc
gccgcgtacgagaaccccttcggtaccttccccggaggcatggaggacctgcgttccacg
cttcactgggtgcagtccaccgccaccgagatgctgagcatgaagaaccgtgccgaggag
atggtctccgtacggctctacgagttcgaccgtgcccggcagttggacctgacgcggatg
agccgccgggaactcgacgcggaactcgcccgctacctcggcttcttccacgacgcgcac
gtcggttatatgccgtactacatcaatgccttcgggttctacggcgtcctcacggagttg
tgcgcgaagtggctcggtgccgacggcgacaacctgcagaaccggatcaagaccgacatg
tcgagtctgcggaccgtcgcgtcggcacaggagatctggggcgtggcccaggccgccaag
gccaggcctcgcgtcatggggatcatcaacgaggcccccctggaggagatcgaggagcgg
ctgcgccaagatgtcgagggcctggccttctgggacacgcagatgaagcccttcctgcgg
gccaacggcacccgcgggcgccaggagatggagctcacccacccgcgctggatcgacgac
ccgtcgtacatcttccagatgatccgccgctacgccgccgacgggctctccgtcgacgac
atcatgggacgcagccgtgcgctcgcggacggcgacgcccggacggtgctggagaagctg
ccgctgcacaggcggaaggtcctcgaaaccgtcatcacgatgtacagcctgtgcagcgag
ctccgcgagaccacccgtatgtcgatgatcacctcgatctggctggtcaggaacgtcgtg
tacgaggtgggccggcgactcgtcgcggaaggagtcctgcactccctggacgaggtcgcc
ttcctcgacttcgaggacgtccgggcctacctggccggtggcgccacggaacgtgagtcg
ttcccccgcacagaactggacgaacgacggcgcctgtacgagtaccacaaccggctgccc
gaaccgtcgctcacgttcatcggagagcacgacatcacccgggcggtgcggccggcggcc
gacggcgcacacctcgtgggtctcggatccagccccgggcggatcgtgggccgtgcccgc
atcgtggaggacctggtctggcaggccgacgagttcctgcccggcgagatcctggtcacc
cgctacaccgacgcgtcctggacgccgctcttcgccatcgccggcggagtggtcaccgac
atcgggtcgatgctctcgcacagttcgatcgtgtcccgggagttcaacgtgccctccgtg
gtcaacaccaagtacgccacgcagcgcatcaacacgggcgacatgatcgtcgtcgacggc
gacaccggcgtcgtcgaagtcgtcgagggctga

DBGET integrated database retrieval system