Streptomyces liliifuscus: JEQ17_32800 Help Entry JEQ17_32800       CDS       T08169                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism slf  Streptomyces liliifuscus Pathway slf00253   Tetracycline biosynthesis slf01056   Biosynthesis of type II polyketide backbone slf01100   Metabolic pathways slf01110   Biosynthesis of secondary metabolites Module slf_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:slf00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     JEQ17_32800    00253 Tetracycline biosynthesis     JEQ17_32800  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:slf01004]     JEQ17_32800    01008 Polyketide biosynthesis proteins [BR:slf01008]     JEQ17_32800 Lipid biosynthesis proteins [BR:slf01004]  Polyketide synthase   Component type    JEQ17_32800 Polyketide biosynthesis proteins [BR:slf01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      JEQ17_32800     Nonaketide PKS      JEQ17_32800     Decaketide PKS      JEQ17_32800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 MPS2 PP-binding_2 T3S_SPI-1_N0 DUF7080 Motif Other DBs NCBI-ProteinID:  QQM43695 UniProt:  A0A7T7REI6 LinkDB All DBs Position 7632249..7632503 Genome browser AA seq 84 aa AA seqDB search MAEFTITEFQSVVNDCFDGATSEEIKDSTLHTEFTDLGFDSLTVYEIVTRIQDDFKVSVP DEQLDELTTPAALIQYVQGQLTAV NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggctgaattcaccatcaccgagttccagagcgtcgtgaacgactgcttcgacggagcc accagtgaggagatcaaggattccacgctgcacaccgagttcaccgacctcggtttcgac tcgctcaccgtgtacgagatcgtgacccgcatccaggacgacttcaaggtcagcgtgccc gacgaacagctcgacgaactcaccacccccgccgccctcatccagtacgtccaaggtcag ctcaccgctgtgtga

DBGET integrated database retrieval system