Streptomyces liliifuscus: JEQ17_32820 Help Entry JEQ17_32820       CDS       T08169                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism slf  Streptomyces liliifuscus Pathway slf00253   Tetracycline biosynthesis slf01056   Biosynthesis of type II polyketide backbone slf01100   Metabolic pathways slf01110   Biosynthesis of secondary metabolites Module slf_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:slf00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     JEQ17_32820    00253 Tetracycline biosynthesis     JEQ17_32820  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:slf01004]     JEQ17_32820    01008 Polyketide biosynthesis proteins [BR:slf01008]     JEQ17_32820 Lipid biosynthesis proteins [BR:slf01004]  Polyketide synthase   Component type    JEQ17_32820 Polyketide biosynthesis proteins [BR:slf01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      JEQ17_32820     Nonaketide PKS      JEQ17_32820     Decaketide PKS      JEQ17_32820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QQM43699 UniProt:  A0A7T7KZJ1 LinkDB All DBs Position 7636542..7636796 Genome browser AA seq 84 aa AA seqDB search MTITLDDLVLVLTECAGADDDVTLNGQNLDLPFTDLGYDSLALLETAALMKHRFGVELTD EEVTGIETPREFLDRVNHAAAQAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccatcaccctcgacgacctggtcctcgtgctcaccgagtgcgccggcgccgacgac gacgtcacgctcaacggccagaacctggacctgcccttcaccgacctcggctacgactcg ctggcgctgctggagacggcggccctgatgaagcaccggttcggggtcgagctcaccgac gaggaggtcaccgggatagagacgccccgggagttcctcgaccgggtcaaccacgctgcg gcccaggccgcctga

DBGET integrated database retrieval system