Streptomyces liangshanensis: HA039_05730 Help Entry HA039_05730       CDS       T07519                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism slia  Streptomyces liangshanensis Pathway slia00253   Tetracycline biosynthesis slia01056   Biosynthesis of type II polyketide backbone slia01100   Metabolic pathways slia01110   Biosynthesis of secondary metabolites Module slia_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:slia00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     HA039_05730    00253 Tetracycline biosynthesis     HA039_05730  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:slia01004]     HA039_05730    01008 Polyketide biosynthesis proteins [BR:slia01008]     HA039_05730 Lipid biosynthesis proteins [BR:slia01004]  Polyketide synthase   Component type    HA039_05730 Polyketide biosynthesis proteins [BR:slia01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      HA039_05730     Nonaketide PKS      HA039_05730     Decaketide PKS      HA039_05730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QIQ06728 UniProt:  A0A6G9H847 LinkDB All DBs Position complement(1308334..1308582) Genome browser AA seq 82 aa AA seqDB search MTIDELKEFLLRTLGEDETVDLSGDILDTGLAELGFDSLAVIATTSSLEQHFRIKVPEEA YSDIKTPGDFLTVFNQQLTAPA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt ctgaccatcgacgagctcaaggaattcctgctgcgcacgctgggagaggacgagacggtg gacctgtccggggacatcctggacaccggtctcgccgagctgggcttcgactccctcgcc gtcatcgcgaccacgagcagcctggagcagcacttcaggatcaaggtgccggaggaggcc tactcggacatcaagacccccggggacttcctcaccgtcttcaaccagcagctgaccgct cccgcgtga

DBGET integrated database retrieval system